{ "uniprot_canonical_ac": "P36088-1", "uniprot_ac": "P36088", "uniprot_id": "FRMSR_YEAST", "mass": { "chemical_mass": 19734.0, "monoisotopic_mass": 19734.0 }, "refseq": { "ac": "NP_012854", "name": "L-methionine (R)-S-oxide reductase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012854" }, "gene_names": [ { "name": "YKG9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012854", "id": "NP_012854" }, { "name": "YKL340", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P36088", "id": "P36088" } ], "protein_names": [ { "name": "Free methionine-R-sulfoxide reductase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P36088" }, { "name": "1.8.4.14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36088" }, { "name": "GAF domain-containing protein YKL069W", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36088" }, { "name": "L-methionine (R)-S-oxide reductase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012854", "id": "NP_012854" }, { "name": "fRMsr", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36088" } ], "function": [ { "annotation": "Catalyzes the reversible oxidation-reduction of the R-enantiomer of free methionine sulfoxide to methionine. Does not act on S-enantiomer of free methionine sulfoxide or R-enantiomer of dabsylated methionine sulfoxide. Involved in protection against oxidative stress.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088#function" }, { "database": "PubMed", "id": "19049972", "url": "https://glygen.org/publication/PubMed/19049972" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 101, "end_pos": 101, "sequence_org": "C", "sequence_mut": "S", "comment": "Dramatic reduction in enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" }, { "database": "PubMed", "id": "19049972", "url": "https://glygen.org/publication/PubMed/19049972" } ] }, { "start_pos": 125, "end_pos": 125, "sequence_org": "C", "sequence_mut": "S", "comment": "Dramatic reduction in enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" }, { "database": "PubMed", "id": "19049972", "url": "https://glygen.org/publication/PubMed/19049972" } ] }, { "start_pos": 91, "end_pos": 91, "sequence_org": "C", "sequence_mut": "S", "comment": "Dramatic reduction in enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" }, { "database": "PubMed", "id": "19049972", "url": "https://glygen.org/publication/PubMed/19049972" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/P36088", "locus": {} } ], "crossref": [ { "id": "853794", "url": "https://www.ncbi.nlm.nih.gov/gene/853794", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P36088", "url": "https://www.ebi.ac.uk/intact/interactors/id:P36088*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000614", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000614", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003018", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003018", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029016", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029016", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YKL069W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKL069W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DNYIACS", "url": "https://omabrowser.org/oma/group/DNYIACS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3716715at2759", "url": "http://www.orthodb.org/?query=3716715at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21021", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21021", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21021:SF15", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21021:SF15", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1F5M", "url": "https://www.rcsb.org/structure/1F5M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KO6", "url": "https://www.rcsb.org/structure/3KO6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF13185", "url": "http://pfam.xfam.org/family/PF13185", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P36088", "url": "http://purl.obolibrary.org/obo/PR_P36088", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012854", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012854", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001552", "url": "https://www.yeastgenome.org/locus/S000001552", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P36088-1", "url": "https://www.uniprot.org/uniprot/P36088-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGSSTGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVFK", "length": 180, "header": "sp|P36088-1|FRMSR_YEAST Isoform 1 of Free methionine-R-sulfoxide reductase OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=P36088-1" }, "isoforms": [ { "isoform_ac": "P36088-1", "url": "", "sequence": { "sequence": "MGSSTGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVFK", "length": 180, "header": "sp|P36088-1|FRMSR_YEAST Isoform 1 of Free methionine-R-sulfoxide reductase OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=P36088-1" }, "locus": { "chromosome": "XI", "start_pos": 307824, "end_pos": 307285, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YKL069W_mRNA", "url": "https://www.ensembl.org/id/YKL069W_mRNA" }, { "database": "Ensembl Peptide", "id": "YKL069W", "url": "https://www.ensembl.org/id/YKL069W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Structure of the GAF domain, a ubiquitous signaling motif and a new class of cyclic GMP receptor.", "journal": "EMBO J.", "date": "2000", "authors": "Hurley J.H., Ho Y.S., Burden L.M.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "reference": [ { "type": "PubMed", "id": "11032796", "url": "https://glygen.org/publication/PubMed/11032796" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Functional analysis of free methionine-R-sulfoxide reductase from Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Le Dung Tien, Lee Byung Cheon, Marino Stefano M, Zhang Yan, Fomenko Dmitri E, Kaya Alaattin, Hacioglu Elise, Kwak Geun-Hee, Koc Ahmet, Kim Hwa-Young, Gladyshev Vadim N", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "reference": [ { "type": "PubMed", "id": "19049972", "url": "https://glygen.org/publication/PubMed/19049972" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Sequence of a 20.7 kb region of yeast chromosome XI includes the NUP100 gene, an open reading frame (ORF) possibly representing a nucleoside diphosphate kinase gene, tRNAs for His, Val and Trp in addition to seven ORFs with weak or no significant similarity to known proteins.", "journal": "Yeast", "date": "1994", "authors": "Rasmussen S.W.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "reference": [ { "type": "PubMed", "id": "8091863", "url": "https://glygen.org/publication/PubMed/8091863" } ] }, { "title": "Complete DNA sequence of yeast chromosome XI.", "journal": "Nature", "date": "1994", "authors": "Ansorge W., Duesterhoeft A., Mewes H.-W., Obermaier B., Wiemann S., Legrain P., Zimmermann J., Xu G., Rose M., Planta R.J., Colleaux L., Rieger M., Fukuhara H., Portetelle D., Mueller S., Becker I., Feldmann H., Kleine K., Gonzalez A., Hewitt N., Schwager C., Voss H., Jimenez A., Erfle H., Jauniaux J.-C., Jacquier A., Dion C., Maia e Silva A., Pallier C., Stegemann J., Andre B., Cheret G., Sor F., Haasemann M., Koetter P., Entian K.-D., Baladron V., Vilela C., Thierry A., Louis E.J., Hollenberg C.P., Marck C., Santos M.A., Soares H., Philippsen P., Poehlmann R., Vandenbol M., Domdey H., Garcia-Ramirez J.J., Pohl T.M., James C.M., Pfeiffer F., Ghazvini M., Ballesta J.P.G., Bossier P., Daignan-Fornier B., Dujon B., Esteban P.F., Fernandes L., Goffeau A., Hegemann J.H., Hilger F., Oliver S.G., Remacha M.A., Revuelta J.L., Rodrigues-Pousada C., Vissers S., del Rey F., van Dyck L., Alexandraki D., Bolotin-Fukuhara M., Duesterhus S., Guerreiro P., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Tzermia M., Urrestarazu L.A., Banrevi A., Bolle P.-A., Bou G., Boyer J., Buitrago M.J., Fobo G.M., Fritz C., Gabel C., Gaillon L., Garcia-Cantalejo J.M., Gent M.E., Grothues D., Horaitis O., Indge K.J., Keuchel H., Liebl S., Moestl D., Monnier A.-L., Pascolo S., Pohl F.M., Puzos V., Rasmussen S.W., Richard G.-F., Rupp T., Sensen C., Tettelin H., Valens M., van Vliet-Reedijk J.C., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "reference": [ { "type": "PubMed", "id": "8196765", "url": "https://glygen.org/publication/PubMed/8196765" } ] } ], "pathway": [ { "id": "sce:YKL069W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKL069W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "L-methionine-(R)-S-oxide reductase activity", "id": "GO:0033745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033745", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "pmid": "" }, { "name": "methionine-R-sulfoxide reductase activity", "id": "GO:0070191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070191", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "cellular response to oxidative stress", "id": "GO:0034599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599", "evidence": [ { "database": "UniProtKB", "id": "P36088", "url": "https://www.uniprot.org/uniprot/P36088" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 14, "end_pos": 16, "annotation": "n_glycosylation_sequon" }, { "start_pos": 174, "end_pos": 176, "annotation": "n_glycosylation_sequon" }, { "start_pos": 45, "end_pos": 47, "annotation": "n_glycosylation_sequon" }, { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "21260", "name": "", "equation": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4FZX5-1", "Q52KJ8-1", "D4A650-1", "Q9Y3D2-1", "Q8IXL7-1", "Q9NZV6-1", "Q8BU85-1", "Q78J03-1", "Q9JLC3-1", "P36088-1" ], "evidence": [ { "id": "21260", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21260" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "D4A650", "gene_name": "Msrb3", "activity": [ { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "D4A650", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A650" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "D4A650", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A650" } ] }, { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "D4A650", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A650" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "D4A650", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A650" } ] } ] }, { "uniprot_ac": "P36088", "gene_name": "", "activity": [ { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "P36088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36088" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "P36088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36088" } ] } ] }, { "uniprot_ac": "Q4FZX5", "gene_name": "Msrb2", "activity": [ { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "Q4FZX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4FZX5" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "Q4FZX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4FZX5" } ] }, { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "Q4FZX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4FZX5" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "Q4FZX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4FZX5" } ] } ] }, { "uniprot_ac": "Q52KJ8", "gene_name": "Msrb1", "activity": [ { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "Q52KJ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q52KJ8" } ] }, { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "Q52KJ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q52KJ8" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "Q52KJ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q52KJ8" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "Q52KJ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q52KJ8" } ] } ] }, { "uniprot_ac": "Q78J03", "gene_name": "Msrb2", "activity": [ { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "Q78J03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q78J03" } ] }, { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "Q78J03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q78J03" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "Q78J03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q78J03" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "Q78J03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q78J03" } ] } ] }, { "uniprot_ac": "Q8BU85", "gene_name": "Msrb3", "activity": [ { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "Q8BU85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU85" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "Q8BU85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU85" } ] }, { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "Q8BU85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU85" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "Q8BU85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU85" } ] } ] }, { "uniprot_ac": "Q8IXL7", "gene_name": "MSRB3", "activity": [ { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "Q8IXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXL7" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "Q8IXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXL7" } ] }, { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "Q8IXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXL7" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "Q8IXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXL7" } ] } ] }, { "uniprot_ac": "Q9JLC3", "gene_name": "Msrb1", "activity": [ { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "Q9JLC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLC3" } ] }, { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "Q9JLC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLC3" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "Q9JLC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLC3" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "Q9JLC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLC3" } ] } ] }, { "uniprot_ac": "Q9NZV6", "gene_name": "MSRB1", "activity": [ { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "Q9NZV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZV6" } ] }, { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "Q9NZV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZV6" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "Q9NZV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZV6" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "Q9NZV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZV6" } ] } ] }, { "uniprot_ac": "Q9Y3D2", "gene_name": "MSRB2", "activity": [ { "ec_number": "1.8.4.14", "activity": "[thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (R)-S-oxide.", "evidence": [ { "id": "Q9Y3D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3D2" } ] }, { "ec_number": "1.8.4.14", "activity": "", "evidence": [ { "id": "Q9Y3D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3D2" } ] }, { "ec_number": "1.8.4.12", "activity": "[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein].", "evidence": [ { "id": "Q9Y3D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3D2" } ] }, { "ec_number": "1.8.4.12", "activity": "", "evidence": [ { "id": "Q9Y3D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3D2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }