{ "uniprot_canonical_ac": "P36053-1", "uniprot_ac": "P36053", "uniprot_id": "ELF1_YEAST", "mass": { "chemical_mass": 16157.0, "monoisotopic_mass": 16157.0 }, "refseq": { "ac": "NP_012762", "name": "Elf1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012762" }, "gene_names": [ { "name": "ELF1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P36053", "id": "P36053" }, { "name": "ELF1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012762", "id": "NP_012762" }, { "name": "YKL614", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P36053", "id": "P36053" } ], "protein_names": [ { "name": "Transcription elongation factor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P36053" }, { "name": "Elf1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012762", "id": "NP_012762" } ], "function": [ { "annotation": "Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053#function" }, { "database": "PubMed", "id": "16260625", "url": "https://glygen.org/publication/PubMed/16260625" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "common_name": "Yeast" } ], "gene": [ { "name": "ELF1", "url": "https://www.uniprot.org/uniprot/P36053", "locus": {} } ], "crossref": [ { "id": "853697", "url": "https://www.ncbi.nlm.nih.gov/gene/853697", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P36053", "url": "https://www.ebi.ac.uk/intact/interactors/id:P36053*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007808", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007808", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038567", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038567", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YKL160W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKL160W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HEKSITC", "url": "https://omabrowser.org/oma/group/HEKSITC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "276470at2759", "url": "http://www.orthodb.org/?query=276470at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR20934", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20934", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20934:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20934:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05129", "url": "http://pfam.xfam.org/family/PF05129", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P36053", "url": "http://purl.obolibrary.org/obo/PR_P36053", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012762", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012762", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001643", "url": "https://www.yeastgenome.org/locus/S000001643", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P36053-1", "url": "https://www.uniprot.org/uniprot/P36053-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKRKKSTRKPTKRLVQKLDTKFNCLFCNHEKSVSCTLDKKNSIGTLSCKICGQSFQTRINSLSQPVDVYSDWFDAVEEVNSGRGSDTDDGDEGSDSDYESDSEQDAKTQNDGEIDSDEEEVDSDEERIGQVKRGRGALVDSDDE", "length": 145, "header": "sp|P36053-1|ELF1_YEAST Isoform 1 of Transcription elongation factor 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=ELF1 PE=1 SV=1 CANONICAL=P36053-1" }, "isoforms": [ { "isoform_ac": "P36053-1", "url": "", "sequence": { "sequence": "MGKRKKSTRKPTKRLVQKLDTKFNCLFCNHEKSVSCTLDKKNSIGTLSCKICGQSFQTRINSLSQPVDVYSDWFDAVEEVNSGRGSDTDDGDEGSDSDYESDSEQDAKTQNDGEIDSDEEEVDSDEERIGQVKRGRGALVDSDDE", "length": 145, "header": "sp|P36053-1|ELF1_YEAST Isoform 1 of Transcription elongation factor 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=ELF1 PE=1 SV=1 CANONICAL=P36053-1" }, "locus": { "chromosome": "XI", "start_pos": 153703, "end_pos": 153269, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YKL160W_mRNA", "url": "https://www.ensembl.org/id/YKL160W_mRNA" }, { "database": "Ensembl Peptide", "id": "YKL160W", "url": "https://www.ensembl.org/id/YKL160W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 109, "end_pos": 109, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Thr109" }, { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "PubMed", "id": "16756761", "url": "https://glygen.org/publication/PubMed/16756761" }, { "database": "SGD", "id": "P36053", "url": "https://www.yeastgenome.org/locus/P36053" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser117" }, { "start_pos": 124, "end_pos": 124, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P36053", "url": "https://www.yeastgenome.org/locus/P36053" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser124" }, { "start_pos": 142, "end_pos": 142, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" }, { "database": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" }, { "database": "SGD", "id": "P36053", "url": "https://www.yeastgenome.org/locus/P36053" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser142" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" }, { "database": "SGD", "id": "P36053", "url": "https://www.yeastgenome.org/locus/P36053" } ], "site_lbl": "Ser55" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" }, { "database": "PubMed", "id": "16756761", "url": "https://glygen.org/publication/PubMed/16756761" } ], "site_lbl": "Ser95" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005-03", "authors": "Gruhler Albrecht, Olsen Jesper V, Mohammed Shabaz, Mortensen Peter, Faergeman Nils J, Mann Matthias, Jensen Ole N", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" } ] }, { "title": "Identification and characterization of Elf1, a conserved transcription elongation factor in Saccharomyces cerevisiae.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Prather D, Krogan NJ, Emili A, Greenblatt JF, Winston F", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "reference": [ { "type": "PubMed", "id": "16260625", "url": "https://glygen.org/publication/PubMed/16260625" } ] }, { "title": "Yeast elf1 factor is phosphorylated and interacts with protein kinase CK2.", "journal": "Journal of biochemistry and molecular biology", "date": "2006-05-31", "authors": "Kubinski Konrad, Zielinski Rafal, Hellman Ulf, Mazur Elzbieta, Szyszka Ryszard", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "16756761", "url": "https://glygen.org/publication/PubMed/16756761" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" }, { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" }, { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Characterization of the rapamycin-sensitive phosphoproteome reveals that Sch9 is a central coordinator of protein synthesis.", "journal": "Genes & development", "date": "2009-08-15", "authors": "Huber Alexandre, Bodenmiller Bernd, Uotila Aino, Stahl Michael, Wanka Stefanie, Gerrits Bertran, Aebersold Ruedi, Loewith Robbie", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" }, { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.", "journal": "Molecular biology of the cell", "date": "2010-10-01", "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P36053", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36053" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "DNA sequencing of a 36.2 kb fragment located between the FAS1 and LAP loci of chromosome XI of Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1994", "authors": "Portetelle D., Dion C., Vandenbol M., Hilger F., Bolle P.-A.", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "reference": [ { "type": "PubMed", "id": "8091859", "url": "https://glygen.org/publication/PubMed/8091859" } ] }, { "title": "Complete DNA sequence of yeast chromosome XI.", "journal": "Nature", "date": "1994", "authors": "Ansorge W., Duesterhoeft A., Mewes H.-W., Obermaier B., Wiemann S., Legrain P., Zimmermann J., Xu G., Rose M., Planta R.J., Colleaux L., Rieger M., Fukuhara H., Portetelle D., Mueller S., Becker I., Feldmann H., Kleine K., Gonzalez A., Hewitt N., Schwager C., Voss H., Jimenez A., Erfle H., Jauniaux J.-C., Jacquier A., Dion C., Maia e Silva A., Pallier C., Stegemann J., Andre B., Cheret G., Sor F., Haasemann M., Koetter P., Entian K.-D., Baladron V., Vilela C., Thierry A., Louis E.J., Hollenberg C.P., Marck C., Santos M.A., Soares H., Philippsen P., Poehlmann R., Vandenbol M., Domdey H., Garcia-Ramirez J.J., Pohl T.M., James C.M., Pfeiffer F., Ghazvini M., Ballesta J.P.G., Bossier P., Daignan-Fornier B., Dujon B., Esteban P.F., Fernandes L., Goffeau A., Hegemann J.H., Hilger F., Oliver S.G., Remacha M.A., Revuelta J.L., Rodrigues-Pousada C., Vissers S., del Rey F., van Dyck L., Alexandraki D., Bolotin-Fukuhara M., Duesterhus S., Guerreiro P., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Tzermia M., Urrestarazu L.A., Banrevi A., Bolle P.-A., Bou G., Boyer J., Buitrago M.J., Fobo G.M., Fritz C., Gabel C., Gaillon L., Garcia-Cantalejo J.M., Gent M.E., Grothues D., Horaitis O., Indge K.J., Keuchel H., Liebl S., Moestl D., Monnier A.-L., Pascolo S., Pohl F.M., Puzos V., Rasmussen S.W., Richard G.-F., Rupp T., Sensen C., Tettelin H., Valens M., van Vliet-Reedijk J.C., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "reference": [ { "type": "PubMed", "id": "8196765", "url": "https://glygen.org/publication/PubMed/8196765" } ] } ], "pathway": [ { "id": "sce:YKL160W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKL160W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "pmid": "" }, { "name": "transcription elongation factor complex", "id": "GO:0008023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008023", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "pmid": "" }, { "name": "RNA polymerase II complex binding", "id": "GO:0000993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000993", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "transcription initiation-coupled chromatin remodeling", "id": "GO:0045815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045815", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "pmid": "" }, { "name": "transcription elongation by RNA polymerase II", "id": "GO:0006368", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006368", "evidence": [ { "database": "UniProtKB", "id": "P36053", "url": "https://www.uniprot.org/uniprot/P36053" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }