{ "uniprot_canonical_ac": "P36013-1", "uniprot_ac": "P36013", "uniprot_id": "MAOM_YEAST", "mass": { "chemical_mass": 74376.0, "monoisotopic_mass": 74376.0 }, "refseq": { "ac": "NP_012896", "name": "malate dehydrogenase (oxaloacetate-decarboxylating)", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012896" }, "gene_names": [ { "name": "MAE1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P36013", "id": "P36013" }, { "name": "MAE1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012896", "id": "NP_012896" } ], "protein_names": [ { "name": "NAD-dependent malic enzyme, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P36013" }, { "name": "1.1.1.38", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36013" }, { "name": "NAD-ME", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36013" }, { "name": "malate dehydrogenase (oxaloacetate-decarboxylating)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012896", "id": "NP_012896" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "common_name": "Yeast" } ], "gene": [ { "name": "MAE1", "url": "https://www.uniprot.org/uniprot/P36013", "locus": {} } ], "crossref": [ { "id": "cd05312", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05312", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "853839", "url": "https://www.ncbi.nlm.nih.gov/gene/853839", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P36013", "url": "https://www.ebi.ac.uk/intact/interactors/id:P36013*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001891", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001891", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012301", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012301", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012302", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012302", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015884", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015884", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037062", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037062", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046346", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046346", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YKL029C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKL029C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QIVNHMV", "url": "https://omabrowser.org/oma/group/QIVNHMV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1069499at2759", "url": "http://www.orthodb.org/?query=1069499at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23406", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23406", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23406:SF34", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23406:SF34", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00390", "url": "http://pfam.xfam.org/family/PF00390", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03949", "url": "http://pfam.xfam.org/family/PF03949", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P36013", "url": "http://purl.obolibrary.org/obo/PR_P36013", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012896", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012896", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001512", "url": "https://www.yeastgenome.org/locus/S000001512", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P36013-1", "url": "https://www.uniprot.org/uniprot/P36013-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLRTRLSVSVAARSQLTRSLTASRTAPLRRWPIQQSRLYSSNTRSHKATTTRENTFQKPYSDEEVTKTPVGSRARKIFEAPHPHATRLTVEGAIECPLESFQLLNSPLFNKGSAFTQEEREAFNLEALLPPQVNTLDEQLERSYKQLCYLKTPLAKNDFMTSLRVQNKVLYFALIRRHIKELVPIIYTPTEGDAIAAYSHRFRKPEGVFLDITEPDSIECRLATYGGDKDVDYIVVSDSEGILGIGDQGIGGVRIAISKLALMTLCGGIHPGRVLPVCLDVGTNNKKLARDELYMGNKFSRIRGKQYDDFLEKFIKAVKKVYPSAVLHFEDFGVKNARRLLEKYRYELPSFNDDIQGTGAVVMASLIAALKHTNRDLKDTRVLIYGAGSAGLGIADQIVNHMVTHGVDKEEARKKIFLMDRRGLILQSYEANSTPAQHVYAKSDAEWAGINTRSLHDVVENVKPTCLVGCSTQAGAFTQDVVEEMHKHNPRPIIFPLSNPTRLHEAVPADLMKWTNNNALVATGSPFPPVDGYRISENNNCYSFPGIGLGAVLSRATTITDKMISAAVDQLAELSPLREGDSRPGLLPGLDTITNTSARLATAVILQALEEGTARIEQEQVPGGAPGETVKVPRDFDECLQWVKAQMWEPVYRPMIKVQHDPSVHTNQL", "length": 669, "header": "sp|P36013-1|MAOM_YEAST Isoform 1 of NAD-dependent malic enzyme, mitochondrial OS=Saccharomyces cerevisiae S288C OX=559292 GN=MAE1 PE=1 SV=1 CANONICAL=P36013-1" }, "isoforms": [ { "isoform_ac": "P36013-1", "url": "", "sequence": { "sequence": "MLRTRLSVSVAARSQLTRSLTASRTAPLRRWPIQQSRLYSSNTRSHKATTTRENTFQKPYSDEEVTKTPVGSRARKIFEAPHPHATRLTVEGAIECPLESFQLLNSPLFNKGSAFTQEEREAFNLEALLPPQVNTLDEQLERSYKQLCYLKTPLAKNDFMTSLRVQNKVLYFALIRRHIKELVPIIYTPTEGDAIAAYSHRFRKPEGVFLDITEPDSIECRLATYGGDKDVDYIVVSDSEGILGIGDQGIGGVRIAISKLALMTLCGGIHPGRVLPVCLDVGTNNKKLARDELYMGNKFSRIRGKQYDDFLEKFIKAVKKVYPSAVLHFEDFGVKNARRLLEKYRYELPSFNDDIQGTGAVVMASLIAALKHTNRDLKDTRVLIYGAGSAGLGIADQIVNHMVTHGVDKEEARKKIFLMDRRGLILQSYEANSTPAQHVYAKSDAEWAGINTRSLHDVVENVKPTCLVGCSTQAGAFTQDVVEEMHKHNPRPIIFPLSNPTRLHEAVPADLMKWTNNNALVATGSPFPPVDGYRISENNNCYSFPGIGLGAVLSRATTITDKMISAAVDQLAELSPLREGDSRPGLLPGLDTITNTSARLATAVILQALEEGTARIEQEQVPGGAPGETVKVPRDFDECLQWVKAQMWEPVYRPMIKVQHDPSVHTNQL", "length": 669, "header": "sp|P36013-1|MAOM_YEAST Isoform 1 of NAD-dependent malic enzyme, mitochondrial OS=Saccharomyces cerevisiae S288C OX=559292 GN=MAE1 PE=1 SV=1 CANONICAL=P36013-1" }, "locus": { "chromosome": "XI", "start_pos": 384725, "end_pos": 382719, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YKL029C_mRNA", "url": "https://www.ensembl.org/id/YKL029C_mRNA" }, { "database": "Ensembl Peptide", "id": "YKL029C", "url": "https://www.ensembl.org/id/YKL029C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The proteome of Saccharomyces cerevisiae mitochondria.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Sickmann A., Zahedi R.P., Rehling P., Chacinska A., Guiard B., Meyer H.E., Meisinger C., Reinders J., Pfanner N., Joppich C., Perschil I., Schoenfisch B., Wagner Y.", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "reference": [ { "type": "PubMed", "id": "14576278", "url": "https://glygen.org/publication/PubMed/14576278" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete DNA sequence of yeast chromosome XI.", "journal": "Nature", "date": "1994", "authors": "Ansorge W., Duesterhoeft A., Mewes H.-W., Obermaier B., Wiemann S., Legrain P., Zimmermann J., Xu G., Rose M., Planta R.J., Colleaux L., Rieger M., Fukuhara H., Portetelle D., Mueller S., Becker I., Feldmann H., Kleine K., Gonzalez A., Hewitt N., Schwager C., Voss H., Jimenez A., Erfle H., Jauniaux J.-C., Jacquier A., Dion C., Maia e Silva A., Pallier C., Stegemann J., Andre B., Cheret G., Sor F., Haasemann M., Koetter P., Entian K.-D., Baladron V., Vilela C., Thierry A., Louis E.J., Hollenberg C.P., Marck C., Santos M.A., Soares H., Philippsen P., Poehlmann R., Vandenbol M., Domdey H., Garcia-Ramirez J.J., Pohl T.M., James C.M., Pfeiffer F., Ghazvini M., Ballesta J.P.G., Bossier P., Daignan-Fornier B., Dujon B., Esteban P.F., Fernandes L., Goffeau A., Hegemann J.H., Hilger F., Oliver S.G., Remacha M.A., Revuelta J.L., Rodrigues-Pousada C., Vissers S., del Rey F., van Dyck L., Alexandraki D., Bolotin-Fukuhara M., Duesterhus S., Guerreiro P., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Tzermia M., Urrestarazu L.A., Banrevi A., Bolle P.-A., Bou G., Boyer J., Buitrago M.J., Fobo G.M., Fritz C., Gabel C., Gaillon L., Garcia-Cantalejo J.M., Gent M.E., Grothues D., Horaitis O., Indge K.J., Keuchel H., Liebl S., Moestl D., Monnier A.-L., Pascolo S., Pohl F.M., Puzos V., Rasmussen S.W., Richard G.-F., Rupp T., Sensen C., Tettelin H., Valens M., van Vliet-Reedijk J.C., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "reference": [ { "type": "PubMed", "id": "8196765", "url": "https://glygen.org/publication/PubMed/8196765" } ] }, { "title": "Identification and characterization of MAE1, the Saccharomyces cerevisiae structural gene encoding mitochondrial malic enzyme.", "journal": "J. Bacteriol.", "date": "1998", "authors": "Boles E., Pronk J.T., de Jong-Gubbels P.", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "reference": [ { "type": "PubMed", "id": "9603875", "url": "https://glygen.org/publication/PubMed/9603875" } ] } ], "pathway": [ { "id": "sce:YKL029C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKL029C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P06801-1", "protein_name": "NADP-dependent malic enzyme", "gene_name": "Me1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEPRAPRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAEVISQQVSDKHLQEGRLYPPLNTIRGVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSSQMYSTNYDQILPDCYPWPAEVQKIQTKVNQ", "length": 572 }, "evidence": [ { "id": "P36013", "url": "https://omabrowser.org/oma/group/P36013/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P48163-1", "protein_name": "NADP-dependent malic enzyme", "gene_name": "ME1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ", "length": 572 }, "evidence": [ { "id": "P36013", "url": "https://omabrowser.org/oma/group/P36013/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "oxaloacetate decarboxylase activity", "id": "GO:0008948", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008948", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" }, { "name": "NAD binding", "id": "GO:0051287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051287", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" }, { "name": "malate dehydrogenase (decarboxylating) (NAD+) activity", "id": "GO:0004471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004471", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" }, { "name": "malic enzyme activity", "id": "GO:0004470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004470", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "pyruvate metabolic process", "id": "GO:0006090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006090", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" }, { "name": "amino acid metabolic process", "id": "GO:0006520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006520", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" }, { "name": "malate metabolic process", "id": "GO:0006108", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006108", "evidence": [ { "database": "UniProtKB", "id": "P36013", "url": "https://www.uniprot.org/uniprot/P36013" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 432, "end_pos": 434, "annotation": "n_glycosylation_sequon" }, { "start_pos": 595, "end_pos": 597, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12653", "name": "", "equation": "(S)-malate + NAD(+) = CO2 + NADH + pyruvate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P23368-1", "Q99KE1-1", "P36013-1" ], "evidence": [ { "id": "12653", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12653" } ] }, { "id": "15641", "name": "", "equation": "H(+) + oxaloacetate = CO2 + pyruvate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AYQ8-1", "P13697-1", "Q6P587-1", "Q16798-1", "P48163-1", "P23368-1", "Q8R0F8-1", "Q8BMF3-1", "Q99KE1-1", "P06801-1", "P40011-1", "P36013-1", "Q6TU48-1" ], "evidence": [ { "id": "15641", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15641" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P06801", "gene_name": "Me1", "activity": [ { "ec_number": "1.1.1.40", "activity": "(S)-malate + NADP(+) = CO2 + NADPH + pyruvate.", "evidence": [ { "id": "P06801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06801" } ] }, { "ec_number": "1.1.1.40", "activity": "", "evidence": [ { "id": "P06801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06801" } ] } ] }, { "uniprot_ac": "P13697", "gene_name": "Me1", "activity": [ { "ec_number": "1.1.1.40", "activity": "(S)-malate + NADP(+) = CO2 + NADPH + pyruvate.", "evidence": [ { "id": "P13697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13697" } ] }, { "ec_number": "1.1.1.40", "activity": "", "evidence": [ { "id": "P13697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13697" } ] } ] }, { "uniprot_ac": "P23368", "gene_name": "ME2", "activity": [ { "ec_number": "1.1.1.38", "activity": "H(+) + oxaloacetate = CO2 + pyruvate.", "evidence": [ { "id": "P23368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23368" } ] }, { "ec_number": "1.1.1.38", "activity": "", "evidence": [ { "id": "P23368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23368" } ] } ] }, { "uniprot_ac": "P36013", "gene_name": "MAE1", "activity": [ { "ec_number": "1.1.1.38", "activity": "H(+) + oxaloacetate = CO2 + pyruvate.", "evidence": [ { "id": "P36013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36013" } ] }, { "ec_number": "1.1.1.38", "activity": "", "evidence": [ { "id": "P36013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36013" } ] } ] }, { "uniprot_ac": "P40011", "gene_name": "", "activity": [ { "ec_number": "4.1.1.112", "activity": "H(+) + oxaloacetate = CO2 + pyruvate.", "evidence": [ { "id": "P40011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40011" } ] }, { "ec_number": "4.1.3.17", "activity": "2-hydroxy-4-oxobutane-1,2,4-tricarboxylate = oxaloacetate + pyruvate.", "evidence": [ { "id": "P40011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40011" } ] }, { "ec_number": "4.1.3.17", "activity": "", "evidence": [ { "id": "P40011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40011" } ] } ] }, { "uniprot_ac": "P48163", "gene_name": "ME1", "activity": [ { "ec_number": "1.1.1.40", "activity": "(S)-malate + NADP(+) = CO2 + NADPH + pyruvate.", "evidence": [ { "id": "P48163", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48163" } ] }, { "ec_number": "1.1.1.40", "activity": "", "evidence": [ { "id": "P48163", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48163" } ] } ] }, { "uniprot_ac": "Q16798", "gene_name": "ME3", "activity": [ { "ec_number": "1.1.1.40", "activity": "(S)-malate + NADP(+) = CO2 + NADPH + pyruvate.", "evidence": [ { "id": "Q16798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16798" } ] }, { "ec_number": "1.1.1.40", "activity": "", "evidence": [ { "id": "Q16798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16798" } ] } ] }, { "uniprot_ac": "Q6AYQ8", "gene_name": "Fahd1", "activity": [ { "ec_number": "3.7.1.5", "activity": "a 3-acylpyruvate + H2O = a carboxylate + H(+) + pyruvate.", "evidence": [ { "id": "Q6AYQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYQ8" } ] }, { "ec_number": "4.1.1.112", "activity": "H(+) + oxaloacetate = CO2 + pyruvate.", "evidence": [ { "id": "Q6AYQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYQ8" } ] }, { "ec_number": "3.7.1.5", "activity": "", "evidence": [ { "id": "Q6AYQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYQ8" } ] } ] }, { "uniprot_ac": "Q6P587", "gene_name": "FAHD1", "activity": [ { "ec_number": "3.7.1.5", "activity": "a 3-acylpyruvate + H2O = a carboxylate + H(+) + pyruvate.", "evidence": [ { "id": "Q6P587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P587" } ] }, { "ec_number": "4.1.1.112", "activity": "H(+) + oxaloacetate = CO2 + pyruvate.", "evidence": [ { "id": "Q6P587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P587" } ] }, { "ec_number": "3.7.1.5", "activity": "", "evidence": [ { "id": "Q6P587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P587" } ] } ] }, { "uniprot_ac": "Q6TU48", "gene_name": "malA", "activity": [ { "ec_number": "1.1.1.40", "activity": "(S)-malate + NADP(+) = CO2 + NADPH + pyruvate.", "evidence": [ { "id": "Q6TU48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6TU48" } ] }, { "ec_number": "1.1.1.40", "activity": "", "evidence": [ { "id": "Q6TU48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6TU48" } ] } ] }, { "uniprot_ac": "Q8BMF3", "gene_name": "Me3", "activity": [ { "ec_number": "1.1.1.40", "activity": "(S)-malate + NADP(+) = CO2 + NADPH + pyruvate.", "evidence": [ { "id": "Q8BMF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BMF3" } ] }, { "ec_number": "1.1.1.40", "activity": "", "evidence": [ { "id": "Q8BMF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BMF3" } ] } ] }, { "uniprot_ac": "Q8R0F8", "gene_name": "Fahd1", "activity": [ { "ec_number": "3.7.1.5", "activity": "a 3-acylpyruvate + H2O = a carboxylate + H(+) + pyruvate.", "evidence": [ { "id": "Q8R0F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0F8" } ] }, { "ec_number": "4.1.1.112", "activity": "H(+) + oxaloacetate = CO2 + pyruvate.", "evidence": [ { "id": "Q8R0F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0F8" } ] }, { "ec_number": "3.7.1.5", "activity": "", "evidence": [ { "id": "Q8R0F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0F8" } ] } ] }, { "uniprot_ac": "Q99KE1", "gene_name": "Me2", "activity": [ { "ec_number": "1.1.1.38", "activity": "H(+) + oxaloacetate = CO2 + pyruvate.", "evidence": [ { "id": "Q99KE1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KE1" } ] }, { "ec_number": "1.1.1.38", "activity": "", "evidence": [ { "id": "Q99KE1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KE1" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }