{ "uniprot_canonical_ac": "P36008-1", "uniprot_ac": "P36008", "uniprot_id": "EF1G2_YEAST", "mass": { "chemical_mass": 46520.0, "monoisotopic_mass": 46520.0 }, "refseq": { "ac": "NP_012842", "name": "translation elongation factor EF1B gamma", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012842" }, "gene_names": [ { "name": "TEF4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P36008", "id": "P36008" }, { "name": "EFC1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012842", "id": "NP_012842" }, { "name": "EFC1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P36008", "id": "P36008" }, { "name": "TEF4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012842", "id": "NP_012842" } ], "protein_names": [ { "name": "Elongation factor 1-gamma 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P36008" }, { "name": "EF-1-gamma 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36008" }, { "name": "Eukaryotic elongation factor 1Bgamma 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36008" }, { "name": "Translation elongation factor 1B gamma 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36008" }, { "name": "eEF1Bgamma 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36008" }, { "name": "translation elongation factor EF1B gamma", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012842", "id": "NP_012842" } ], "function": [ { "annotation": "Subunit of the eukaryotic elongation factor 1 complex (eEF1). Probably plays a role in anchoring the complex to other cellular components (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "common_name": "Yeast" } ], "gene": [ { "name": "TEF4", "url": "https://www.uniprot.org/uniprot/P36008", "locus": { "chromosome": "XI", "start_pos": 284455, "end_pos": 282891, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YKL081W", "url": "https://www.ensembl.org/id/YKL081W" } ] } } ], "crossref": [ { "id": "cd03044", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03044", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03181", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03181", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "853781", "url": "https://www.ncbi.nlm.nih.gov/gene/853781", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P36008", "url": "https://www.ebi.ac.uk/intact/interactors/id:P36008*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001662", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001662", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004045", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004045", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004046", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004046", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010987", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010987", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036282", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036282", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036433", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036433", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YKL081W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKL081W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IDANIMK", "url": "https://omabrowser.org/oma/group/IDANIMK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "159792at2759", "url": "http://www.orthodb.org/?query=159792at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43986", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43986", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43986:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43986:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00043", "url": "http://pfam.xfam.org/family/PF00043", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00647", "url": "http://pfam.xfam.org/family/PF00647", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02798", "url": "http://pfam.xfam.org/family/PF02798", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P36008", "url": "http://purl.obolibrary.org/obo/PR_P36008", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012842", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012842", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001564", "url": "https://www.yeastgenome.org/locus/S000001564", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P36008-1", "url": "https://www.uniprot.org/uniprot/P36008-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSQGTLYINRSPRNYASEALISYFKLDVKIVDLEQSSEFASLFPLKQAPAFLGPKGLKLTEALAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSFKGLIPYNKKDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRAKHPHLMRWFNTVAASPIVKTPFAEVKLAEKALTYTPPKKQKAEKPKAEKSKAEKKKDEAKPADDAAPAKKPKHPLEALGKSTFVLDDWKRKYSNDDTRPVALPWFWEHYNPEEYSIWKVGYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDFAPAFDVAPDWESYEYTKLDPTKEEDKEFVNNMWAWDKPVVVNGEDKEIVDGKVLK", "length": 412, "header": "sp|P36008-1|EF1G2_YEAST Isoform 1 of Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=TEF4 PE=1 SV=1 CANONICAL=P36008-1" }, "isoforms": [ { "isoform_ac": "P36008-1", "url": "", "sequence": { "sequence": "MSQGTLYINRSPRNYASEALISYFKLDVKIVDLEQSSEFASLFPLKQAPAFLGPKGLKLTEALAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSFKGLIPYNKKDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRAKHPHLMRWFNTVAASPIVKTPFAEVKLAEKALTYTPPKKQKAEKPKAEKSKAEKKKDEAKPADDAAPAKKPKHPLEALGKSTFVLDDWKRKYSNDDTRPVALPWFWEHYNPEEYSIWKVGYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDFAPAFDVAPDWESYEYTKLDPTKEEDKEFVNNMWAWDKPVVVNGEDKEIVDGKVLK", "length": 412, "header": "sp|P36008-1|EF1G2_YEAST Isoform 1 of Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=TEF4 PE=1 SV=1 CANONICAL=P36008-1" }, "locus": { "chromosome": "XI", "start_pos": 284452, "end_pos": 282891, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YKL081W_mRNA", "url": "https://www.ensembl.org/id/YKL081W_mRNA" }, { "database": "Ensembl Peptide", "id": "YKL081W", "url": "https://www.ensembl.org/id/YKL081W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 215, "end_pos": 215, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36008", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36008" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P36008", "url": "https://www.yeastgenome.org/locus/P36008" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr215" }, { "start_pos": 261, "end_pos": 261, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36008", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36008" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ], "site_lbl": "Ser261" }, { "start_pos": 85, "end_pos": 85, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36008", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36008" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P36008", "url": "https://www.yeastgenome.org/locus/P36008" } ], "site_lbl": "Ser85" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Cloning and mutational analysis of the gene encoding subunit C of yeast vacuolar H(+)-ATPase.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Nelson N., Pan Y.-C.E., Nelson H., Kopecky J., Beltran C.", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "reference": [ { "type": "PubMed", "id": "1730668", "url": "https://glygen.org/publication/PubMed/1730668" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P36008", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36008" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "iPTMnet", "id": "P36008", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36008" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P36008", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36008" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P36008", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36008" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "reference": [ { "type": "PubMed", "id": "22814378", "url": "https://glygen.org/publication/PubMed/22814378" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P36008", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36008" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Multiple genes encode the translation elongation factor EF-1 gamma in Saccharomyces cerevisiae.", "journal": "Nucleic Acids Res.", "date": "1994", "authors": "Kinzy T.G., Woolford J.L. Jr., Ripmaster T.L.", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "reference": [ { "type": "PubMed", "id": "8041634", "url": "https://glygen.org/publication/PubMed/8041634" } ] }, { "title": "Complete DNA sequence of yeast chromosome XI.", "journal": "Nature", "date": "1994", "authors": "Ansorge W., Duesterhoeft A., Mewes H.-W., Obermaier B., Wiemann S., Legrain P., Zimmermann J., Xu G., Rose M., Planta R.J., Colleaux L., Rieger M., Fukuhara H., Portetelle D., Mueller S., Becker I., Feldmann H., Kleine K., Gonzalez A., Hewitt N., Schwager C., Voss H., Jimenez A., Erfle H., Jauniaux J.-C., Jacquier A., Dion C., Maia e Silva A., Pallier C., Stegemann J., Andre B., Cheret G., Sor F., Haasemann M., Koetter P., Entian K.-D., Baladron V., Vilela C., Thierry A., Louis E.J., Hollenberg C.P., Marck C., Santos M.A., Soares H., Philippsen P., Poehlmann R., Vandenbol M., Domdey H., Garcia-Ramirez J.J., Pohl T.M., James C.M., Pfeiffer F., Ghazvini M., Ballesta J.P.G., Bossier P., Daignan-Fornier B., Dujon B., Esteban P.F., Fernandes L., Goffeau A., Hegemann J.H., Hilger F., Oliver S.G., Remacha M.A., Revuelta J.L., Rodrigues-Pousada C., Vissers S., del Rey F., van Dyck L., Alexandraki D., Bolotin-Fukuhara M., Duesterhus S., Guerreiro P., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Tzermia M., Urrestarazu L.A., Banrevi A., Bolle P.-A., Bou G., Boyer J., Buitrago M.J., Fobo G.M., Fritz C., Gabel C., Gaillon L., Garcia-Cantalejo J.M., Gent M.E., Grothues D., Horaitis O., Indge K.J., Keuchel H., Liebl S., Moestl D., Monnier A.-L., Pascolo S., Pohl F.M., Puzos V., Rasmussen S.W., Richard G.-F., Rupp T., Sensen C., Tettelin H., Valens M., van Vliet-Reedijk J.C., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "reference": [ { "type": "PubMed", "id": "8196765", "url": "https://glygen.org/publication/PubMed/8196765" } ] } ], "pathway": [ { "id": "sce:YKL081W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKL081W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" }, { "name": "ribosome", "id": "GO:0005840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005840", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" }, { "name": "cytoplasmic stress granule", "id": "GO:0010494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010494", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" }, { "name": "eukaryotic translation elongation factor 1 complex", "id": "GO:0005853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005853", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "guanyl-nucleotide exchange factor activity", "id": "GO:0005085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005085", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" }, { "name": "translation elongation factor activity", "id": "GO:0003746", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003746", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "translational elongation", "id": "GO:0006414", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006414", "evidence": [ { "database": "UniProtKB", "id": "P36008", "url": "https://www.uniprot.org/uniprot/P36008" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 154, "end_pos": 156, "annotation": "n_glycosylation_sequon" }, { "start_pos": 9, "end_pos": 11, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }