{ "uniprot_canonical_ac": "P35433-1", "uniprot_ac": "P35433", "uniprot_id": "PUR1_RAT", "mass": { "chemical_mass": 57437.0, "monoisotopic_mass": 57437.0 }, "refseq": { "ac": "NP_476546", "name": "amidophosphoribosyltransferase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476546" }, "gene_names": [ { "name": "Ppat", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P35433", "id": "P35433" }, { "name": "Atase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476546", "id": "NP_476546" }, { "name": "Ppat", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476546", "id": "NP_476546" } ], "protein_names": [ { "name": "Amidophosphoribosyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P35433" }, { "name": "2.4.2.14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35433" }, { "name": "ATase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35433" }, { "name": "GPAT; glutamine phosphoribosylpyrophosphate amidotransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476546", "id": "NP_476546" }, { "name": "GPAT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35433" }, { "name": "Glutamine phosphoribosylpyrophosphate amidotransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35433" }, { "name": "amidophosphoribosyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476546", "id": "NP_476546" } ], "function": [ { "annotation": "Catalyzes the formation of phosphoribosylamine from phosphoribosylpyrophosphate (PRPP) and glutamine.", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433#function" }, { "database": "PubMed", "id": "8463258", "url": "https://glygen.org/publication/PubMed/8463258" } ] } ], "disease": [ { "disease_id": "DOID:4450", "recommended_name": { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "renal cell carcinoma", "description": "A renal carcinoma that has_material_basis_in the lining of the proximal convoluted renal tubule of the kidney." }, "synonyms": [ { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "RCC", "description": "" }, { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "adenocarcinoma of kidney", "description": "" }, { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "hypernephroma", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, Xp11-associated", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, Xp11-associated", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, papillary, 1", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "RCCX1", "description": "" } ], "evidence": [ { "id": "4450", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4450" } ] }, { "disease_id": "DOID:684", "recommended_name": { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "hepatocellular carcinoma", "description": "A liver carcinoma that has_material_basis_in undifferentiated hepatocytes and located_in the liver." }, "synonyms": [ { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "Hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MIM:114550", "resource": "MIM", "url": "https://www.omim.org/entry/114550", "name": "Hepatocellular carcinoma", "description": "Hepatocellular carcinoma" } ], "evidence": [ { "id": "684", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:684" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ppat", "url": "https://www.uniprot.org/uniprot/P35433", "locus": { "chromosome": "14", "start_pos": 31250144, "end_pos": 31216165, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000002128", "url": "https://www.ensembl.org/id/ENSRNOG00000002128" } ] } } ], "crossref": [ { "id": "ENSRNOG00000002128", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000002128", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00715", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00715", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd06223", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06223", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "117544", "url": "https://www.ncbi.nlm.nih.gov/gene/117544", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000836", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000836", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005854", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005854", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017932", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017932", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035584", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035584", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:117544", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:117544", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ENAQPTF", "url": "https://omabrowser.org/oma/group/ENAQPTF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4975at2759", "url": "http://www.orthodb.org/?query=4975at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11907", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11907", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11907:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11907:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13522", "url": "http://pfam.xfam.org/family/PF13522", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P35433", "url": "http://purl.obolibrary.org/obo/PR_P35433", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-73817", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-73817", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_476546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476546", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "620237", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620237", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "14905", "url": "https://www.rhea-db.org/rhea/14905", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I6A2E8", "url": "https://www.uniprot.org/uniprot/A0A8I6A2E8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A2E8-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A2E8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P35433-1", "url": "https://www.uniprot.org/uniprot/P35433-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELEESGIREECGVFGCIASGDWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPKFRVHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPAAYSLVIMHRDVIYAVRDPYGNRPLCIGRLMPVSDINDKEKKSSETEGWVVSSESCSFLSIGARYCHEVKPGEIVEISRHGVRTLDIIPRSNGDPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAVEAPVEADLVSTVPESATPAALGYATKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLIDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKHPCFMGINIPTKEELIANKPEFEYLAEYLGANSVVYLSVEGLVSSVQQEIKFKKQKVKKRDITIQENGNGLEYFEKTGHCTACLTGQYPVDLEW", "length": 517, "header": "sp|P35433-1|PUR1_RAT Isoform 1 of Amidophosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Ppat PE=1 SV=1 CANONICAL=P35433-1" }, "isoforms": [ { "isoform_ac": "A0A8I6A2E8-1", "url": "", "sequence": { "sequence": "MELEESGIREECGVFGCIASGDWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPKFRVHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPAAYSLVIMHRDVIYAVRDPYGNRPLCIGRLMPVSDINDKGSFLNLKIAGSRASAAFTEKKSSETEGWVVSSESCSFLSIGARYCHEVKPGEIVEISRHGVRTLDIIPRSNGDPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAVEAPVEADLVSTVPESATPAALGYATKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLIDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKHPCFMGINIPTKEELIANKPEFEYLAEYLGANSVVYLSVEGLVSSVQQEIKFKKQKVKKRDITIQENGNGLEYFEKTGHCTACLTGQYPVDLEW", "length": 535, "header": "tr|A0A8I6A2E8-1|A0A8I6A2E8_RAT Computationally mapped isoform of Amidophosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Ppat PE=1 SV=1 CANONICAL=P35433-1" }, "locus": { "chromosome": "14", "start_pos": 31248197, "end_pos": 31216301, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000100016.1", "url": "https://www.ensembl.org/id/ENSRNOT00000100016.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000087004.1", "url": "https://www.ensembl.org/id/ENSRNOP00000087004.1" } ] } }, { "isoform_ac": "P35433-1", "url": "", "sequence": { "sequence": "MELEESGIREECGVFGCIASGDWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPKFRVHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPAAYSLVIMHRDVIYAVRDPYGNRPLCIGRLMPVSDINDKEKKSSETEGWVVSSESCSFLSIGARYCHEVKPGEIVEISRHGVRTLDIIPRSNGDPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAVEAPVEADLVSTVPESATPAALGYATKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLIDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKHPCFMGINIPTKEELIANKPEFEYLAEYLGANSVVYLSVEGLVSSVQQEIKFKKQKVKKRDITIQENGNGLEYFEKTGHCTACLTGQYPVDLEW", "length": 517, "header": "sp|P35433-1|PUR1_RAT Isoform 1 of Amidophosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Ppat PE=1 SV=1 CANONICAL=P35433-1" }, "locus": { "chromosome": "14", "start_pos": 31248197, "end_pos": 31216301, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000002905", "url": "https://www.ensembl.org/id/ENSRNOT00000002905" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000002905", "url": "https://www.ensembl.org/id/ENSRNOP00000002905" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Rat genomic structure of amidophosphoribosyltransferase, cDNA sequence of aminoimidazole ribonucleotide carboxylase, and cell cycle-dependent expression of these two physically linked genes.", "journal": "Biochim. Biophys. Acta", "date": "1995", "authors": "Iwahana H, Honda S, Tsujisawa T, Takahashi Y, Adzuma K, Katashima R, Yamaoka T, Moritani M, Yoshimoto K, Itakura M", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "reference": [ { "type": "PubMed", "id": "7742366", "url": "https://glygen.org/publication/PubMed/7742366" } ] }, { "title": "Molecular cloning of rat amidophosphoribosyltransferase.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Iwahana H, Yamaoka T, Mizutani M, Mizusawa N, Ii S, Yoshimoto K, Itakura M", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "reference": [ { "type": "PubMed", "id": "8463258", "url": "https://glygen.org/publication/PubMed/8463258" } ] } ], "pathway": [ { "id": "rno:117544", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:117544", "resource": "KEGG Pathway" }, { "id": "R-RNO-73817", "name": "Purine ribonucleoside monophosphate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-73817", "resource": "Reactome", "description": "Purine ribonucleoside monophosphate biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "Q06203-1", "protein_name": "Amidophosphoribosyltransferase", "gene_name": "PPAT", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW", "length": 517 }, "evidence": [ { "id": "45227854", "url": "http://www.informatics.jax.org/homology/45227854", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8CIH9-1", "protein_name": "Amidophosphoribosyltransferase", "gene_name": "Ppat", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELEELGIREECGVFGCIASGDWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSAVPKFRVHKGMGLVNHVFTEDNLKKLYDSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRQGIGLSTSSDSEMITQLLAYTPPQEKDDAPDWVARIKNLMKEAPAAYSLVIMHRDFIYAVRDPYGNRPLCIGRLMPVSDVNDKEKKSSETEGWVVSSESCSFLSIGARYCHEVKPGEIVEISRHGIRTLDIIPRSNGDPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVEADLVSTVPESATPAALGYATKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLIDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDCLAEYLGANSVVYLSVEGLVSSVQQEIKFKKQKVKKHDIAIQENGNGLEYFEKTGHCTACLTGQYPVELEW", "length": 517 }, "evidence": [ { "id": "45227854", "url": "http://www.informatics.jax.org/homology/45227854", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "amidophosphoribosyltransferase activity", "id": "GO:0004044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004044", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "iron-sulfur cluster binding", "id": "GO:0051536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051536", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "4 iron, 4 sulfur cluster binding", "id": "GO:0051539", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051539", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "GMP biosynthetic process", "id": "GO:0006177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006177", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "purine nucleobase biosynthetic process", "id": "GO:0009113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009113", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "'de novo' IMP biosynthetic process", "id": "GO:0006189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006189", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "'de novo' AMP biosynthetic process", "id": "GO:0044208", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044208", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "'de novo' XMP biosynthetic process", "id": "GO:0097294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097294", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "cellular response to insulin stimulus", "id": "GO:0032869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032869", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "kidney development", "id": "GO:0001822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001822", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "cellular response to xenobiotic stimulus", "id": "GO:0071466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071466", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "maternal process involved in female pregnancy", "id": "GO:0060135", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060135", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "G1/S transition of mitotic cell cycle", "id": "GO:0000082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000082", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "lactation", "id": "GO:0007595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007595", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "animal organ regeneration", "id": "GO:0031100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031100", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "purine nucleotide biosynthetic process", "id": "GO:0006164", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006164", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" }, { "name": "glutamine catabolic process", "id": "GO:0006543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006543", "evidence": [ { "database": "UniProtKB", "id": "P35433", "url": "https://www.uniprot.org/uniprot/P35433" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14905", "name": "", "equation": "5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P35433-1", "Q06203-1", "Q8CIH9-1", "P04046-1", "Q86A85-1", "Q27601-1", "Q967S0-1" ], "evidence": [ { "id": "14905", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14905" } ] }, { "id": "R-RNO-111285", "name": "Formation of phosphoribosyl pyrophosphate amidotransferase tetramer", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P35433-1" ], "evidence": [ { "id": "R-RNO-111285", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-111285" } ] }, { "id": "R-RNO-111289", "name": "Dissociation of phosphoribosyl pyrophosphate amidotransferase tetramer", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P35433-1" ], "evidence": [ { "id": "R-RNO-111289", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-111289" } ] }, { "id": "R-RNO-73815", "name": "5-phospho-alpha-D-ribose 1-diphosphate (PRPP) + H2O + L-glutamine <=> 5-phosphoribosylamine + L-glutamate +pyrophosphate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-111292" ], "enzyme_list": [ "P35433-1" ], "evidence": [ { "id": "R-RNO-73815", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-73815" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-111292", "participant_name": "PRA [cytosol]", "crossref": [ { "id": "C03090", "database": "COMPOUND", "url": "" }, { "id": "58681", "database": "ChEBI", "url": "" }, { "id": "000004096019", "database": "ZINC", "url": "" }, { "id": "58681", "database": "ChEBI", "url": "" }, { "id": "000004096019", "database": "ZINC", "url": "" }, { "id": "C03090", "database": "COMPOUND", "url": "" }, { "id": "58681", "database": "ChEBI", "url": "" }, { "id": "C03090", "database": "COMPOUND", "url": "" }, { "id": "000004096019", "database": "ZINC", "url": "" }, { "id": "C03090", "database": "COMPOUND", "url": "" }, { "id": "58681", "database": "ChEBI", "url": "" }, { "id": "000004096019", "database": "ZINC", "url": "" }, { "id": "C03090", "database": "COMPOUND", "url": "" }, { "id": "58681", "database": "ChEBI", "url": "" }, { "id": "000004096019", "database": "ZINC", "url": "" }, { "id": "C03090", "database": "COMPOUND", "url": "" }, { "id": "58681", "database": "ChEBI", "url": "" }, { "id": "000004096019", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P04046", "gene_name": "ADE4", "activity": [ { "ec_number": "2.4.2.14", "activity": "5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine.", "evidence": [ { "id": "P04046", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04046" } ] }, { "ec_number": "2.4.2.14", "activity": "", "evidence": [ { "id": "P04046", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04046" } ] } ] }, { "uniprot_ac": "P35433", "gene_name": "Ppat", "activity": [ { "ec_number": "2.4.2.14", "activity": "5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine.", "evidence": [ { "id": "P35433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35433" } ] }, { "ec_number": "2.4.2.14", "activity": "", "evidence": [ { "id": "P35433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35433" } ] } ] }, { "uniprot_ac": "Q06203", "gene_name": "PPAT", "activity": [ { "ec_number": "2.4.2.14", "activity": "5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine.", "evidence": [ { "id": "Q06203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06203" } ] }, { "ec_number": "2.4.2.14", "activity": "", "evidence": [ { "id": "Q06203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06203" } ] } ] }, { "uniprot_ac": "Q27601", "gene_name": "Prat", "activity": [ { "ec_number": "2.4.2.14", "activity": "5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine.", "evidence": [ { "id": "Q27601", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27601" } ] }, { "ec_number": "2.4.2.14", "activity": "", "evidence": [ { "id": "Q27601", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27601" } ] } ] }, { "uniprot_ac": "Q86A85", "gene_name": "purF", "activity": [ { "ec_number": "2.4.2.14", "activity": "5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine.", "evidence": [ { "id": "Q86A85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86A85" } ] }, { "ec_number": "2.4.2.14", "activity": "", "evidence": [ { "id": "Q86A85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86A85" } ] } ] }, { "uniprot_ac": "Q8CIH9", "gene_name": "Ppat", "activity": [ { "ec_number": "2.4.2.14", "activity": "5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine.", "evidence": [ { "id": "Q8CIH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIH9" } ] }, { "ec_number": "2.4.2.14", "activity": "", "evidence": [ { "id": "Q8CIH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIH9" } ] } ] }, { "uniprot_ac": "Q967S0", "gene_name": "Prat2", "activity": [ { "ec_number": "2.4.2.14", "activity": "5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = 5-phospho-alpha-D-ribose 1-diphosphate + H2O + L-glutamine.", "evidence": [ { "id": "Q967S0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q967S0" } ] }, { "ec_number": "2.4.2.14", "activity": "", "evidence": [ { "id": "Q967S0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q967S0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }