{ "uniprot_canonical_ac": "P35282-1", "uniprot_ac": "P35282", "uniprot_id": "RAB21_MOUSE", "mass": { "chemical_mass": 24106.0, "monoisotopic_mass": 24106.0 }, "refseq": { "ac": "NP_077774", "name": "ras-related protein Rab-21", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774" }, "gene_names": [ { "name": "Rab21", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P35282", "id": "P35282" }, { "name": "9630024B22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774", "id": "NP_077774" }, { "name": "Rab21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774", "id": "NP_077774" } ], "protein_names": [ { "name": "Ras-related protein Rab-21", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P35282" }, { "name": "Rab-12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35282" }, { "name": "rab-12", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774", "id": "NP_077774" }, { "name": "ras-related protein Rab-21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774", "id": "NP_077774" } ], "function": [ { "annotation": "Rab21 Protein Is Degraded by Both the Ubiquitin-Proteasome Pathway and the Autophagy-Lysosome Pathway. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_077774", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774" }, { "database": "PubMed", "id": "35163051", "url": "https://glygen.org/publication/PubMed/35163051" } ] }, { "annotation": "Rab21 mediates caerulin-induced MKK3-p38 activation and pro-inflammatory responses.", "evidence": [ { "database": "RefSeq", "id": "NP_077774", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774" }, { "database": "PubMed", "id": "31402118", "url": "https://glygen.org/publication/PubMed/31402118" } ] }, { "annotation": "Rab21 regulates LPS-induced pro-inflammatory responses by promoting TLR4 endosomal traffic and downstream signaling activation", "evidence": [ { "database": "RefSeq", "id": "NP_077774", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774" }, { "database": "PubMed", "id": "30471852", "url": "https://glygen.org/publication/PubMed/30471852" } ] }, { "annotation": "Small GTPase involved in membrane trafficking control (PubMed:16754960, PubMed:18804435). Regulates integrin internalization and recycling, but does not influence the traffic of endosomally translocated receptors in general (PubMed:16754960). As a result, may regulate cell adhesion and migration (PubMed:16754960). During the mitosis of adherent cells, controls the endosomal trafficking of integrins which is required for the successful completion of cytokinesis (PubMed:18804435). Involved in neurite growth (By similarity). Following SBF2/MTMT13-mediated activation in response to starvation-induced autophagy, binds to and regulates SNARE protein VAMP8 endolysosomal transport required for SNARE-mediated autophagosome-lysosome fusion (By similarity). Modulates protein levels of the cargo receptors TMED2 and TMED10, and required for appropriate Golgi localization of TMED10 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282#function" }, { "database": "UniProtKB", "id": "Q9UL25", "url": "https://www.uniprot.org/uniprot/Q9UL25#function" }, { "database": "PubMed", "id": "16754960", "url": "https://glygen.org/publication/PubMed/16754960" }, { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5#function" }, { "database": "PubMed", "id": "18804435", "url": "https://glygen.org/publication/PubMed/18804435" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 31, "end_pos": 31, "sequence_org": "T", "sequence_mut": "N", "comment": "Defects in GTP-binding. Decrease in integrin-binding.", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" }, { "database": "PubMed", "id": "16754960", "url": "https://glygen.org/publication/PubMed/16754960" } ] }, { "start_pos": 76, "end_pos": 76, "sequence_org": "Q", "sequence_mut": "L", "comment": "Defects in GTP hydrolysis. Increase in integrin-binding.", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" }, { "database": "PubMed", "id": "16754960", "url": "https://glygen.org/publication/PubMed/16754960" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Rab21", "url": "https://www.uniprot.org/uniprot/P35282", "locus": { "chromosome": "10", "start_pos": 115122989, "end_pos": 115151499, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020132", "url": "https://www.ensembl.org/id/ENSMUSG00000020132" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020132", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020132", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04123", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04123", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "216344", "url": "https://www.ncbi.nlm.nih.gov/gene/216344", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P35282", "url": "https://www.ebi.ac.uk/intact/interactors/id:P35282*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041833", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041833", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:216344", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:216344", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "894308", "url": "http://www.informatics.jax.org/marker/MGI:894308", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P35282", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P35282", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MHFHTSA", "url": "https://omabrowser.org/oma/group/MHFHTSA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5483572at2759", "url": "http://www.orthodb.org/?query=5483572at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47978:SF52", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47978:SF52", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08477", "url": "http://pfam.xfam.org/family/PF08477", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P35282", "url": "http://purl.obolibrary.org/obo/PR_P35282", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8873719", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8876198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_077774", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1W2P6Z4", "url": "https://www.uniprot.org/uniprot/A0A1W2P6Z4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2P6Z4-1", "url": "https://www.uniprot.org/uniprot/A0A1W2P6Z4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P35282-1", "url": "https://www.uniprot.org/uniprot/P35282-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG", "length": 222, "header": "sp|P35282-1|RAB21_MOUSE Isoform 1 of Ras-related protein Rab-21 OS=Mus musculus OX=10090 GN=Rab21 PE=1 SV=4 CANONICAL=P35282-1" }, "isoforms": [ { "isoform_ac": "A0A1W2P6Z4-1", "url": "", "sequence": { "sequence": "MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQVQTPGSRAGDPRPLLCLWPVKPPSLPSHCLLQSLWGPAGLSTR", "length": 94, "header": "tr|A0A1W2P6Z4-1|RAB21_MOUSE Computationally mapped isoform of Ras-related protein Rab-21 OS=Mus musculus OX=10090 GN=Rab21 PE=1 SV=1 CANONICAL=P35282-1" }, "locus": { "chromosome": "10", "start_pos": 115151251, "end_pos": 115150970, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000218831.2", "url": "https://www.ensembl.org/id/ENSMUST00000218831.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000151464.2", "url": "https://www.ensembl.org/id/ENSMUSP00000151464.2" } ] } }, { "isoform_ac": "P35282-1", "url": "", "sequence": { "sequence": "MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG", "length": 222, "header": "sp|P35282-1|RAB21_MOUSE Isoform 1 of Ras-related protein Rab-21 OS=Mus musculus OX=10090 GN=Rab21 PE=1 SV=4 CANONICAL=P35282-1" }, "locus": { "chromosome": "10", "start_pos": 115151251, "end_pos": 115126680, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000020343", "url": "https://www.ensembl.org/id/ENSMUST00000020343" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000020343", "url": "https://www.ensembl.org/id/ENSMUSP00000020343" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P35282", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P35282" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The complexity of the Rab and Rho GTP-binding protein subfamilies revealed by a PCR cloning approach.", "journal": "Gene", "date": "1992", "authors": "Chavrier P, Simons K, Zerial M", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "reference": [ { "type": "PubMed", "id": "1555775", "url": "https://glygen.org/publication/PubMed/1555775" } ] }, { "title": "Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins.", "journal": "J. Cell Biol.", "date": "2006", "authors": "Pellinen T, Arjonen A, Vuoriluoto K, Kallio K, Fransen JA, Ivaska J", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "reference": [ { "type": "PubMed", "id": "16754960", "url": "https://glygen.org/publication/PubMed/16754960" } ] }, { "title": "Integrin trafficking regulated by Rab21 is necessary for cytokinesis.", "journal": "Dev. Cell", "date": "2008", "authors": "Pellinen T, Tuomi S, Arjonen A, Wolf M, Edgren H, Meyer H, Grosse R, Kitzing T, Rantala JK, Kallioniemi O, Fassler R, Kallio M, Ivaska J", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "reference": [ { "type": "PubMed", "id": "18804435", "url": "https://glygen.org/publication/PubMed/18804435" } ] }, { "title": "Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth.", "journal": "EMBO Rep.", "date": "2009", "authors": "Burgo A, Sotirakis E, Simmler MC, Verraes A, Chamot C, Simpson JC, Lanzetti L, Proux-Gillardeaux V, Galli T", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "reference": [ { "type": "PubMed", "id": "19745841", "url": "https://glygen.org/publication/PubMed/19745841" } ] }, { "title": "Requirement of Rab21 in LPS-induced TLR4 signaling and pro-inflammatory responses in macrophages and monocytes.", "journal": "Biochemical and biophysical research communications", "date": "2019", "authors": "Li P, Wu YH, Zhu YT, Li MX, Pei HH", "evidence": [ { "database": "RefSeq", "id": "NP_077774", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774" } ], "reference": [ { "type": "PubMed", "id": "30471852", "url": "https://glygen.org/publication/PubMed/30471852" } ] }, { "title": "Rab GTPase 21 mediates caerulin-induced TRAF3-MKK3-p38 activation and acute pancreatitis response.", "journal": "Biochemical and biophysical research communications", "date": "2019", "authors": "Wang N, Meng W, Jia R, Xiang S", "evidence": [ { "database": "RefSeq", "id": "NP_077774", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774" } ], "reference": [ { "type": "PubMed", "id": "31402118", "url": "https://glygen.org/publication/PubMed/31402118" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P35282", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P35282" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "Rab21 Protein Is Degraded by Both the Ubiquitin-Proteasome Pathway and the Autophagy-Lysosome Pathway.", "journal": "International journal of molecular sciences", "date": "2022", "authors": "Liu P, Wu A, Li H, Zhang J, Ni J, Quan Z, Qing H", "evidence": [ { "database": "RefSeq", "id": "NP_077774", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077774" } ], "reference": [ { "type": "PubMed", "id": "35163051", "url": "https://glygen.org/publication/PubMed/35163051" } ] } ], "pathway": [ { "id": "mmu:216344", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:216344", "resource": "KEGG Pathway" }, { "id": "R-MMU-8873719", "name": "RAB geranylgeranylation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8873719", "resource": "Reactome", "description": "RAB geranylgeranylation" }, { "id": "R-MMU-8876198", "name": "RAB GEFs exchange GTP for GDP on RABs", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8876198", "resource": "Reactome", "description": "RAB GEFs exchange GTP for GDP on RABs" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6AXT5-1", "protein_name": "Ras-related protein Rab-21", "gene_name": "Rab21", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSGSGGCCSSG", "length": 223 }, "evidence": [ { "id": "45230870", "url": "http://www.informatics.jax.org/homology/45230870", "database": "MGI" }, { "id": "P35282", "url": "https://omabrowser.org/oma/group/P35282/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9UL25-1", "protein_name": "Ras-related protein Rab-21", "gene_name": "RAB21", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG", "length": 225 }, "evidence": [ { "id": "45230870", "url": "http://www.informatics.jax.org/homology/45230870", "database": "MGI" }, { "id": "P35282", "url": "https://omabrowser.org/oma/group/P35282/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 14, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "cleavage furrow", "id": "GO:0032154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032154", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "Golgi cisterna membrane", "id": "GO:0032580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032580", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "cytoplasmic side of plasma membrane", "id": "GO:0009898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009898", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "axon cytoplasm", "id": "GO:1904115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904115", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "vesicle membrane", "id": "GO:0012506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012506", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "cytoplasmic side of early endosome membrane", "id": "GO:0098559", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098559", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "GDP binding", "id": "GO:0019003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019003", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "regulation of axon extension", "id": "GO:0030516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030516", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "anterograde axonal transport", "id": "GO:0008089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008089", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "positive regulation of dendrite morphogenesis", "id": "GO:0050775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050775", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "positive regulation of receptor-mediated endocytosis", "id": "GO:0048260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048260", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "Rab protein signal transduction", "id": "GO:0032482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032482", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "positive regulation of early endosome to late endosome transport", "id": "GO:2000643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000643", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" }, { "name": "regulation of exocytosis", "id": "GO:0017157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017157", "evidence": [ { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 191, "end_pos": 193, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }