{ "uniprot_canonical_ac": "P35181-1", "uniprot_ac": "P35181", "uniprot_id": "AP1S1_YEAST", "mass": { "chemical_mass": 18152.0, "monoisotopic_mass": 18152.0 }, "refseq": { "ac": "NP_013271", "name": "Aps1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013271" }, "gene_names": [ { "name": "APS1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P35181", "id": "P35181" }, { "name": "APS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013271", "id": "NP_013271" }, { "name": "L9470.16", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P35181", "id": "P35181" }, { "name": "YAP19", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013271", "id": "NP_013271" }, { "name": "YAP19", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P35181", "id": "P35181" } ], "protein_names": [ { "name": "AP-1 complex subunit sigma-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P35181" }, { "name": "Aps1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013271", "id": "NP_013271" }, { "name": "Clathrin assembly protein complex 1 sigma-1 small chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35181" }, { "name": "Clathrin coat assembly protein AP19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35181" }, { "name": "Clathrin coat-associated protein AP19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35181" }, { "name": "Golgi adaptor AP-1 19 kDa adaptin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35181" }, { "name": "HA1 19 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35181" }, { "name": "Sigma1-adaptin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P35181" } ], "function": [ { "annotation": "Component of the adapter complexes which link clathrin to receptors in coated vesicles (PubMed:10564262). Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration (PubMed:10564262). AP19 is probably a subunit of the Golgi membrane adapter (PubMed:10564262). Component of the AP-1-related (AP-1R) complex, an adapter protein complex that mediates sorting of cargo SNARE SNC1 (PubMed:26658609). In contrast to the APM1-containing AP-1 complex, AP-1R is incapable of sorting CHS3 (PubMed:26658609).", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181#function" }, { "database": "PubMed", "id": "26658609", "url": "https://glygen.org/publication/PubMed/26658609" }, { "database": "PubMed", "id": "10564262", "url": "https://glygen.org/publication/PubMed/10564262" } ] } ], "disease": [ { "disease_id": "DOID:0060483", "recommended_name": { "id": "DOID:0060483", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060483", "name": "MEDNIK syndrome", "description": "A syndrome characterized by mental retardation, enteropathy, deafness, peripheral neuropathy, ichthyosis, and keratoderma. It is cause by homozygous mutation in the AP1S1 gene on chromosome 7q22." }, "synonyms": [ { "id": "DOID:0060483", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060483", "name": "erythrokeratodermia variabilis 3", "description": "" }, { "id": "DOID:0060483", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060483", "name": "erythrokeratodermia variabilis, Kamouraska type", "description": "" }, { "id": "DOID:0060483", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060483", "name": "mental retardation, enteropathy, deafness, neuropathy, ichthyosis, keratodermia", "description": "" }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "MEDNIK syndrome", "description": "MEDNIK syndrome, previously known as Erythrokeratodermia Variabilis type 3 (EKV3), is characterized by intellectual deficit, enteropathy, sensorineural hearing loss, peripheral neuropathy, lamellar and erythrodermic ichthyosis, and keratodermia (MEDNIK stands for Mental retardation, Enteropathy, Deafness, peripheral Neuropathy, Ichtyosis, Keratodermia)." }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "erythrokeratodermia variabilis 3", "description": "" }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "erythrokeratodermia variabilis, Kamouraska type", "description": "" }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "intellectual disability, enteropathy, deafness, neuropathy, ichthyosis, keratodermia", "description": "" }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "intellectual disability-enteropathy-deafness-peripheral neuropathy-ichthyosis-keratodermia syndrome", "description": "" }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "mental retardation, enteropathy, deafness, neuropathy, ichthyosis, keratodermia", "description": "" }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "MEDNIK", "description": "" }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "intellectual disability, enteropathy, deafness, peripheral neuropathy, ichthyosis, and keratoderma", "description": "" }, { "id": "MONDO:0012251", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012251", "name": "mental retardation, enteropathy, deafness, peripheral neuropathy, ichthyosis, and keratoderma", "description": "" }, { "id": "MIM:609313", "resource": "MIM", "url": "https://www.omim.org/entry/609313", "name": "MEDNIK syndrome", "description": "MEDNIK syndrome" } ], "evidence": [ { "id": "0060483", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060483" } ] }, { "disease_id": "DOID:0060800", "recommended_name": { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "syndromic X-linked intellectual disability 5", "description": "A syndromic X-linked intellectual disability characterized by intellectual disability and variable features including; choreoathetosis, hydrocephalus, Dandy-Walker malformation, seizures, and iron or calcium deposition in the brain that has_material_basis_in mutation in the AP1S2 gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "X-linked metal retardation with Dandy-Walker malformation, basal ganglia disease, and seizures", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "Fried syndrome", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "MRX59", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "MRXS21", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "Mental retardation, X-linked syndromic 5", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "Pettigrew syndrome", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "X-linked mental retardation 59", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "syndromic X-linked mental retardation 21", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "syndromic X-linked mental retardation Fried type", "description": "" }, { "id": "DOID:0060800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060800", "name": "X-linked intellectual disability-Dandy-Walker malformation-basal ganglia disease-seizures syndrome", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "syndromic X-linked intellectual disability 5", "description": "X-linked Dandy-Walker malformation with intellectual disability, basal ganglia disease and seizures (XDIBS), or Pettigrew syndrome is a central nervous system malformation characterized by severe intellectual deficit, early hypotonia with progression to spasticity and contractures, choreoathetosis, seizures, dysmorphic face (long face with prominent forehead), and brain imaging abnormalities such as Dandy-Walker malformation, and iron deposition." }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "MRX59", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "MRXS21", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "Pettigrew syndrome", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "Pettigrew syndrome, X-linked recessive", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "X-linked intellectual disability 59", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "X-linked intellectual disability-Dandy-Walker malformation-basal ganglia disease-seizures syndrome", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "X-linked intellectual disability-hypotonia-facial dysmorphism-aggressive behavior syndrome", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "X-linked intellectual disability-hypotonia-facial dysmorphism-aggressive behaviour syndrome", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "X-linked mental retardation 59", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "X-linked metal retardation with Dandy-Walker malformation, basal ganglia disease, and seizures", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "intellectual disability, X-linked syndromic 5", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "mental retardation, X-linked syndromic 5", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "syndromic X-linked intellectual disability 21", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "syndromic X-linked intellectual disability fried type", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "syndromic X-linked intellectual disability type 5", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "syndromic X-linked mental retardation 21", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "syndromic X-linked mental retardation fried type", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "Dandy-Walker malformation with intellectual disability, basal ganglia disease and seizures", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "MRXS5", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "PETTIGREW syndrome", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "PGS", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "X-linked intellectual disability - Dandy-Walker malformation - basal ganglia disease - seizures", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "fried syndrome", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "intellectual disability X-linked syndromic 5", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "intellectual disability X-linked with Dandy-Walker malformation basal ganglia disease and seizures", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "intellectual disability, X-linked 59", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "intellectual disability, X-linked, syndromic 21", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "intellectual disability, X-linked, syndromic 5", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "intellectual disability, X-linked, syndromic, fried type", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "intellectual disability, X-linked, with Dandy-Walker malformation, basal ganglia disease, and seizures", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "mental retardation X-linked syndromic 5", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "mental retardation X-linked with Dandy-Walker malformation basal ganglia disease and seizures", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "mental retardation, X-linked 59", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "mental retardation, X-linked, syndromic 21", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "mental retardation, X-linked, syndromic 5", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "mental retardation, X-linked, syndromic, fried type", "description": "" }, { "id": "MONDO:0010574", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010574", "name": "mental retardation, X-linked, with Dandy-Walker malformation, basal ganglia disease, and seizures", "description": "" }, { "id": "MIM:304340", "resource": "MIM", "url": "https://www.omim.org/entry/304340", "name": "Pettigrew syndrome", "description": "Pettigrew syndrome" } ], "evidence": [ { "id": "0060800", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060800" } ] }, { "disease_id": "DOID:0111281", "recommended_name": { "id": "DOID:0111281", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111281", "name": "psoriasis 15", "description": "A psoriasis characterized by pustular psoriasis that has_material_basis_in heterozygous mutation in the AP1S3 gene on chromosome 2q36.1." }, "synonyms": [ { "id": "DOID:0111281", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111281", "name": "PSORS15", "description": "" }, { "id": "MONDO:0014494", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014494", "name": "psoriasis 15, pustular, susceptibility to", "description": "Any generalized pustular psoriasis in which the cause of the disease is a mutation in the AP1S3 gene." }, { "id": "MONDO:0014494", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014494", "name": "AP1S3 generalised pustular psoriasis", "description": "" }, { "id": "MONDO:0014494", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014494", "name": "AP1S3 generalized pustular psoriasis", "description": "" }, { "id": "MONDO:0014494", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014494", "name": "generalised pustular psoriasis caused by mutation in AP1S3", "description": "" }, { "id": "MONDO:0014494", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014494", "name": "generalized pustular psoriasis caused by mutation in AP1S3", "description": "" }, { "id": "MONDO:0014494", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014494", "name": "psoriasis 15, pustular, susceptibility to", "description": "" }, { "id": "MONDO:0014494", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014494", "name": "PSORS15", "description": "" }, { "id": "MONDO:0014494", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014494", "name": "susceptibility to pustular psoriasis 15", "description": "" }, { "id": "MIM:616106", "resource": "MIM", "url": "https://www.omim.org/entry/616106", "name": "Psoriasis 15, pustular", "description": "Psoriasis 15, pustular" } ], "evidence": [ { "id": "0111281", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111281" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "common_name": "Yeast" } ], "gene": [ { "name": "APS1", "url": "https://www.uniprot.org/uniprot/P35181", "locus": { "chromosome": "XII", "start_pos": 500579, "end_pos": 501049, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YLR170C", "url": "https://www.ensembl.org/id/YLR170C" } ] } } ], "crossref": [ { "id": "cd14831", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14831", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "850868", "url": "https://www.ncbi.nlm.nih.gov/gene/850868", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P35181", "url": "https://www.ebi.ac.uk/intact/interactors/id:P35181*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000804", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000804", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011012", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011012", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016635", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016635", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022775", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022775", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044733", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044733", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YLR170C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR170C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KAYHILD", "url": "https://omabrowser.org/oma/group/KAYHILD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5475372at2759", "url": "http://www.orthodb.org/?query=5475372at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11753", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11753", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11753:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11753:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01217", "url": "http://pfam.xfam.org/family/PF01217", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P35181", "url": "http://purl.obolibrary.org/obo/PR_P35181", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013271", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013271", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004160", "url": "https://www.yeastgenome.org/locus/S000004160", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P35181-1", "url": "https://www.uniprot.org/uniprot/P35181-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTQLKYLLLVSRQGKIRLKKWYTAMSAGEKAKIVKDLTPTILARKPKMCNIIEYNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKVYDILNEMIMCDGSIAESSRKEVLHHVTVMDTMESNDNLERVLS", "length": 156, "header": "sp|P35181-1|AP1S1_YEAST Isoform 1 of AP-1 complex subunit sigma-1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=APS1 PE=1 SV=1 CANONICAL=P35181-1" }, "isoforms": [ { "isoform_ac": "P35181-1", "url": "", "sequence": { "sequence": "MTQLKYLLLVSRQGKIRLKKWYTAMSAGEKAKIVKDLTPTILARKPKMCNIIEYNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKVYDILNEMIMCDGSIAESSRKEVLHHVTVMDTMESNDNLERVLS", "length": 156, "header": "sp|P35181-1|AP1S1_YEAST Isoform 1 of AP-1 complex subunit sigma-1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=APS1 PE=1 SV=1 CANONICAL=P35181-1" }, "locus": { "chromosome": "XII", "start_pos": 501049, "end_pos": 500582, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YLR170C_mRNA", "url": "https://www.ensembl.org/id/YLR170C_mRNA" }, { "database": "Ensembl Peptide", "id": "YLR170C", "url": "https://www.ensembl.org/id/YLR170C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Adaptor complex-independent clathrin function in yeast.", "journal": "Mol. Biol. Cell", "date": "1999", "authors": "Payne G.S., Phan H.L., Yeung B.G.", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "reference": [ { "type": "PubMed", "id": "10564262", "url": "https://glygen.org/publication/PubMed/10564262" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The alternate AP-1 adaptor subunit Apm2 interacts with the Mil1 regulatory protein and confers differential cargo sorting.", "journal": "Mol. Biol. Cell", "date": "2016", "authors": "Whitfield Shawn T, Burston Helen E, Bean Bj\u00f6rn D M, Raghuram Nandini, Maldonado-B\u00e1ez Lymarie, Davey Michael, Wendland Beverly, Conibear Elizabeth", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "reference": [ { "type": "PubMed", "id": "26658609", "url": "https://glygen.org/publication/PubMed/26658609" } ] }, { "title": "The Saccharomyces cerevisiae APS1 gene encodes a homolog of the small subunit of the mammalian clathrin AP-1 complex: evidence for functional interaction with clathrin at the Golgi complex.", "journal": "EMBO J.", "date": "1994", "authors": "Kirchhausen T., Payne G.S., Phan H.L., Tan P.K., Chu D.S., Finlay J.A.", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "reference": [ { "type": "PubMed", "id": "8157009", "url": "https://glygen.org/publication/PubMed/8157009" } ] }, { "title": "Cloning of the YAP19 gene encoding a putative yeast homolog of AP19, the mammalian small chain of the clathrin-assembly proteins.", "journal": "Biochim. Biophys. Acta", "date": "1993", "authors": "Takada T., Endo T., Nakai M.", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "reference": [ { "type": "PubMed", "id": "8373805", "url": "https://glygen.org/publication/PubMed/8373805" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] } ], "pathway": [ { "id": "sce:YLR170C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR170C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9DB50-1", "protein_name": "AP-1 complex subunit sigma-2", "gene_name": "Ap1s2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEDAKEAETPRSVLEEIGLT", "length": 160 }, "evidence": [ { "id": "P35181", "url": "https://omabrowser.org/oma/group/P35181/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" }, { "name": "AP-1 adaptor complex", "id": "GO:0030121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030121", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" }, { "name": "vesicle-mediated transport", "id": "GO:0016192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016192", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" }, { "name": "vesicle targeting, trans-Golgi to endosome", "id": "GO:0048203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048203", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" }, { "name": "Golgi to vacuole transport", "id": "GO:0006896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006896", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "clathrin adaptor activity", "id": "GO:0035615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035615", "evidence": [ { "database": "UniProtKB", "id": "P35181", "url": "https://www.uniprot.org/uniprot/P35181" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 109, "end_pos": 111, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }