{
    "uniprot_canonical_ac": "P34730-1",
    "uniprot_ac": "P34730",
    "uniprot_id": "BMH2_YEAST",
    "mass": {
        "chemical_mass": 31061.0,
        "monoisotopic_mass": 31061.0
    },
    "refseq": {
        "ac": "NP_010384",
        "name": "14-3-3 family protein BMH2",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010384"
    },
    "gene_names": [
        {
            "name": "BMH2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P34730",
            "id": "P34730"
        },
        {
            "name": "BMH2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010384",
            "id": "NP_010384"
        },
        {
            "name": "SCD3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010384",
            "id": "NP_010384"
        },
        {
            "name": "YD8557.08",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P34730",
            "id": "P34730"
        }
    ],
    "protein_names": [
        {
            "name": "Protein BMH2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P34730"
        },
        {
            "name": "14-3-3 family protein BMH2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010384",
            "id": "NP_010384"
        }
    ],
    "function": [],
    "disease": [
        {
            "disease_id": "DOID:0060469",
            "recommended_name": {
                "id": "DOID:0060469",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0060469",
                "name": "Miller-Dieker lissencephaly syndrome",
                "description": "A syndrome characterized by classical lissencephaly and distinct facial features and has_material_basis_in submicroscopic deletions of 17p13.3, including the LIS1 gene."
            },
            "synonyms": [
                {
                    "id": "DOID:0060469",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060469",
                    "name": "MDS",
                    "description": ""
                },
                {
                    "id": "DOID:0060469",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060469",
                    "name": "Miller-Dieker syndrome",
                    "description": ""
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "Miller-Dieker lissencephaly syndrome",
                    "description": "A rare syndrome caused by deletion of genetic material in the short arm of chromosome 17. It is characterized by an abnormally smooth brain with fewer folds and grooves. It results in intellectual disability, developmental delay, seizures, spasticity, hypotonia, and feeding difficulties. Affected individuals have distinctive facial features that include a prominent forehead, midface hypoplasia, small, upturned nose, low-set ears, small jaw, and thick upper lip."
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "Miller-Dieker lissencephaly syndrome",
                    "description": ""
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "Miller-Dieker syndrome",
                    "description": ""
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "lissencephaly due to 17p13.3 deletion",
                    "description": ""
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "monosomy 17p13.3",
                    "description": ""
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "telomeric deletion 17p",
                    "description": ""
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "MDLS",
                    "description": ""
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "Miller-Dieker syndrome chromosome region",
                    "description": ""
                },
                {
                    "id": "MONDO:0009532",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009532",
                    "name": "chromosome 17P13.3 deletion syndrome",
                    "description": ""
                },
                {
                    "id": "MIM:247200",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/247200",
                    "name": "Miller-Dieker lissencephaly syndrome",
                    "description": "Miller-Dieker lissencephaly syndrome"
                }
            ],
            "evidence": [
                {
                    "id": "0060469",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0060469"
                }
            ]
        },
        {
            "disease_id": "DOID:0060480",
            "recommended_name": {
                "id": "DOID:0060480",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0060480",
                "name": "left ventricular noncompaction",
                "description": "An intrinsic cardiomyopathy characterized by distinctive (spongy) morphological appearance of the LV myocardium."
            },
            "synonyms": [
                {
                    "id": "DOID:0060480",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060480",
                    "name": "left ventricular hypertrabeculation",
                    "description": ""
                },
                {
                    "id": "MONDO:0011403",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011403",
                    "name": "left ventricular noncompaction 1",
                    "description": "Any left ventricular noncompaction in which the cause of the disease is a mutation in the DTNA gene."
                },
                {
                    "id": "MONDO:0011403",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011403",
                    "name": "DTNA left ventricular noncompaction",
                    "description": ""
                },
                {
                    "id": "MONDO:0011403",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011403",
                    "name": "left ventricular noncompaction 1",
                    "description": ""
                },
                {
                    "id": "MONDO:0011403",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011403",
                    "name": "left ventricular noncompaction 1, with or without congenital heart defects",
                    "description": ""
                },
                {
                    "id": "MONDO:0011403",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011403",
                    "name": "left ventricular noncompaction caused by mutation in DTNA",
                    "description": ""
                },
                {
                    "id": "MONDO:0011403",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011403",
                    "name": "left ventricular noncompaction type 1",
                    "description": ""
                },
                {
                    "id": "MONDO:0011403",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011403",
                    "name": "LVNC1",
                    "description": ""
                },
                {
                    "id": "MONDO:0011403",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011403",
                    "name": "left ventricular noncompaction 1 with or without congenital heart defects",
                    "description": ""
                },
                {
                    "id": "MIM:604169",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/604169",
                    "name": "Left ventricular non-compaction 1",
                    "description": "Left ventricular non-compaction 1"
                }
            ],
            "evidence": [
                {
                    "id": "0060480",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0060480"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "BMH2",
            "url": "https://www.uniprot.org/uniprot/P34730",
            "locus": {
                "chromosome": "IV",
                "start_pos": 654428,
                "end_pos": 653607,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "YDR099W",
                        "url": "https://www.ensembl.org/id/YDR099W"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "cd11309",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11309",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "851676",
            "url": "https://www.ncbi.nlm.nih.gov/gene/851676",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P34730",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P34730*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000308",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000308",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR023409",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR023409",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR023410",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR023410",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036815",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036815",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YDR099W",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR099W",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "PCATTGE",
            "url": "https://omabrowser.org/oma/group/PCATTGE/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "920089at2759",
            "url": "http://www.orthodb.org/?query=920089at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR18860",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18860",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR18860:SF140",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18860:SF140",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00244",
            "url": "http://pfam.xfam.org/family/PF00244",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P34730",
            "url": "http://purl.obolibrary.org/obo/PR_P34730",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_010384",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010384",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000002506",
            "url": "https://www.yeastgenome.org/locus/S000002506",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P34730",
            "url": "https://www.uniprot.org/uniprot/P34730",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P34730-1",
            "url": "https://www.uniprot.org/uniprot/P34730-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSQTREDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELIRSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNSSLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDISESGQEDQQQQQQQQQQQQQQQQQAPAEQTQGEPTK",
        "length": 273,
        "header": "sp|P34730-1|BMH2_YEAST Isoform 1 of Protein BMH2  OS=Saccharomyces cerevisiae S288C OX=559292 GN=BMH2 PE=1 SV=3 CANONICAL=P34730-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P34730-1",
            "url": "",
            "sequence": {
                "sequence": "MSQTREDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELIRSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNSSLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDISESGQEDQQQQQQQQQQQQQQQQQAPAEQTQGEPTK",
                "length": 273,
                "header": "sp|P34730-1|BMH2_YEAST Isoform 1 of Protein BMH2  OS=Saccharomyces cerevisiae S288C OX=559292 GN=BMH2 PE=1 SV=3 CANONICAL=P34730-1"
            },
            "locus": {
                "chromosome": "IV",
                "start_pos": 654425,
                "end_pos": 653607,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YDR099W_mRNA",
                        "url": "https://www.ensembl.org/id/YDR099W_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YDR099W",
                        "url": "https://www.ensembl.org/id/YDR099W"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 104,
            "end_pos": 104,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P34730",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34730"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "SGD",
                    "id": "P34730",
                    "url": "https://www.yeastgenome.org/locus/P34730"
                }
            ],
            "site_lbl": "Ser104"
        },
        {
            "start_pos": 210,
            "end_pos": 210,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P34730",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34730"
                },
                {
                    "database": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ],
            "site_lbl": "Thr210"
        },
        {
            "start_pos": 212,
            "end_pos": 212,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P34730",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34730"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "SGD",
                    "id": "P34730",
                    "url": "https://www.yeastgenome.org/locus/P34730"
                }
            ],
            "site_lbl": "Ser212"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Self-association of the spindle pole body-related intermediate filament protein Fin1p and its phosphorylation-dependent interaction with 14-3-3 proteins in yeast.",
            "journal": "J. Biol. Chem.",
            "date": "2003",
            "authors": "Deelder A.M., Molenaar C., van Heusden G.P.H., Steensma H.Y., van Hemert M.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12551942",
                    "url": "https://glygen.org/publication/PubMed/12551942"
                }
            ]
        },
        {
            "title": "Global analysis of protein localization in budding yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562095",
                    "url": "https://glygen.org/publication/PubMed/14562095"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "High-density yeast-tiling array reveals previously undiscovered introns and extensive regulation of meiotic splicing.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2007",
            "authors": "Davis R.W., Palm C., Miranda M., Juneau K.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17244705",
                    "url": "https://glygen.org/publication/PubMed/17244705"
                }
            ]
        },
        {
            "title": "Genome-wide identification of spliced introns using a tiling microarray.",
            "journal": "Genome Res.",
            "date": "2007",
            "authors": "Zhang Z., Fields S., Hesselberth J.R.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17351133",
                    "url": "https://glygen.org/publication/PubMed/17351133"
                }
            ]
        },
        {
            "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2008-07",
            "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P34730",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                }
            ]
        },
        {
            "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.",
            "journal": "BMC genomics",
            "date": "2010-12-02",
            "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P34730",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ]
        },
        {
            "title": "Role of individual phosphorylation sites for the 14-3-3-protein-dependent activation of yeast neutral trehalase Nth1.",
            "journal": "Biochem. J.",
            "date": "2012",
            "authors": "Veisova Dana, Macakova Eva, Rezabkova Lenka, Sulc Miroslav, Vacha Petr, Sychrova Hana, Obsil Tomas, Obsilova Veronika",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22320399",
                    "url": "https://glygen.org/publication/PubMed/22320399"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "The 14-3-3 proteins encoded by the BMH1 and BMH2 genes are essential in the yeast Saccharomyces cerevisiae and can be replaced by a plant homologue.",
            "journal": "Eur. J. Biochem.",
            "date": "1995",
            "authors": "Carr A.M., Ford J.C., van Heusden G.P.H., Steensma H.Y., Chin-A-Woeng T.F.C., Griffith D.J.F., Schrader P.A.T.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7744048",
                    "url": "https://glygen.org/publication/PubMed/7744048"
                }
            ]
        },
        {
            "title": "14-3-3 proteins: potential roles in vesicular transport and Ras signaling in Saccharomyces cerevisiae.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "1995",
            "authors": "Nelson K.K., Matsumoto K., Irie K., Roseboom P., Lemmon S.K., Gelperin D., Weigle J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8524799",
                    "url": "https://glygen.org/publication/PubMed/8524799"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169867",
                    "url": "https://glygen.org/publication/PubMed/9169867"
                }
            ]
        },
        {
            "title": "Proteome studies of Saccharomyces cerevisiae: identification and characterization of abundant proteins.",
            "journal": "Electrophoresis",
            "date": "1997",
            "authors": "Garrels J I, McLaughlin C S, Warner J R, Futcher B, Latter G I, Kobayashi R, Schwender B, Volpe T, Anderson D S, Mesquita-Fuentes R, Payne W E",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P34730",
                    "url": "https://www.uniprot.org/uniprot/P34730"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9298649",
                    "url": "https://glygen.org/publication/PubMed/9298649"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YDR099W",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR099W",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P62258-1",
            "protein_name": "14-3-3 protein epsilon",
            "gene_name": "YWHAE",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ",
                "length": 255
            },
            "evidence": [
                {
                    "id": "P34730",
                    "url": "https://omabrowser.org/oma/group/P34730/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "P62259-1",
            "protein_name": "14-3-3 protein epsilon",
            "gene_name": "Ywhae",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ",
                "length": 255
            },
            "evidence": [
                {
                    "id": "P34730",
                    "url": "https://omabrowser.org/oma/group/P34730/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "P92177-3",
            "protein_name": "14-3-3 protein epsilon",
            "gene_name": "14-3-3epsilon",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKEQIQDVEDQDVS",
                "length": 262
            },
            "evidence": [
                {
                    "id": "P34730",
                    "url": "https://omabrowser.org/oma/group/P34730/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "DNA replication origin binding",
                        "id": "GO:0003688",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003688",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "phosphoserine residue binding",
                        "id": "GO:0050815",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050815",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 12,
                "go_terms": [
                    {
                        "name": "pre-replicative complex assembly involved in nuclear cell cycle DNA replication",
                        "id": "GO:0006267",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006267",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "signal transduction",
                        "id": "GO:0007165",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of apoptotic process",
                        "id": "GO:0043066",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "Ras protein signal transduction",
                        "id": "GO:0007265",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007265",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of protein ubiquitination",
                        "id": "GO:0031397",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA damage checkpoint signaling",
                        "id": "GO:0000077",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000077",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA replication initiation",
                        "id": "GO:0006270",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006270",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of glycogen metabolic process",
                        "id": "GO:0070873",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070873",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "signal transduction involved in filamentous growth",
                        "id": "GO:0001402",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001402",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "pseudohyphal growth",
                        "id": "GO:0007124",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007124",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ascospore formation",
                        "id": "GO:0030437",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030437",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "fungal-type cell wall chitin biosynthetic process",
                        "id": "GO:0034221",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034221",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P34730",
                                "url": "https://www.uniprot.org/uniprot/P34730"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 148,
            "end_pos": 150,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 178,
            "end_pos": 180,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 229,
            "end_pos": 231,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 13
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}