{ "uniprot_canonical_ac": "P34072-1", "uniprot_ac": "P34072", "uniprot_id": "MKS1_YEAST", "mass": { "chemical_mass": 65643.0, "monoisotopic_mass": 65643.0 }, "refseq": { "ac": "NP_014323", "name": "Mks1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014323" }, "gene_names": [ { "name": "MKS1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P34072", "id": "P34072" }, { "name": "LYS80", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014323", "id": "NP_014323" }, { "name": "LYS80", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P34072", "id": "P34072" }, { "name": "MKS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014323", "id": "NP_014323" }, { "name": "N2344", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P34072", "id": "P34072" }, { "name": "N2347", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P34072", "id": "P34072" } ], "protein_names": [ { "name": "Negative regulator of RAS-cAMP pathway", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P34072" }, { "name": "Mks1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014323", "id": "NP_014323" } ], "function": [ { "annotation": "Negative regulator of Ras-cAMP pathway. Involved in transcriptional regulation of galactose-inducible genes.", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "common_name": "Yeast" } ], "gene": [ { "name": "MKS1", "url": "https://www.uniprot.org/uniprot/P34072", "locus": { "chromosome": "XIV", "start_pos": 485310, "end_pos": 483556, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YNL076W", "url": "https://www.ensembl.org/id/YNL076W" } ] } } ], "crossref": [ { "id": "855648", "url": "https://www.ncbi.nlm.nih.gov/gene/855648", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P34072", "url": "https://www.ebi.ac.uk/intact/interactors/id:P34072*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNL076W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL076W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "P34072", "url": "https://oglcnac.org/atlas/detail/P34072", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P34072", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P34072", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MDIPSKN", "url": "https://omabrowser.org/oma/group/MDIPSKN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1334409at2759", "url": "http://www.orthodb.org/?query=1334409at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28014", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28014", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28014:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28014:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08550", "url": "http://pfam.xfam.org/family/PF08550", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P34072", "url": "http://purl.obolibrary.org/obo/PR_P34072", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014323", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014323", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005020", "url": "https://www.yeastgenome.org/locus/S000005020", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P34072-1", "url": "https://www.uniprot.org/uniprot/P34072-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSREAFDVPNIGTNKFLKVTPNLFTPERLNLFDDVELYLTLIKASKCVEQGERLHNISWRILNKAVLKEHNINRSKKRDGVKNIYYVLNPNNKQPIKPKQAAVKQPPLQKANLPPTTAKQNVLTRPMTSPAIAQGAHDRSLDNPNSTNNDVKNDVAPNRQFSKSTTSGLFSNFADKYQKMKNVNHVANKEEPQTIITGFDTSTVITKKPLQSRRSRSPFQHIGDMNMNCIDNETSKSTSPTLENMGSRKSSFPQKESLFGRPRSYKNDQNGQLSLSKTSSRKGKNKIFFSSEDEDSDWDSVSNDSEFYADEDDEEYDDYNEEEADQYYRRQWDKLLFAKNQQNLDSTKSSVSSANTINSNTSHDPVRKSLLSGLFLSEANSNSNNHNTAHSEYASKHVSPTPQSSHSNIGPQPQQNPPSANGIKQQKPSLKTSNVTALASLSPPQPSNNERLSMDIQKDFKTDNESNHLYESNAPLTAQTILPTALSTHMFLPNNIHQQRMAIATGSNTRHRFSRRQSMDIPSKNRNTGFLKTRMEISEEEKMVRTISRLDNTSIANSNGNGNDDTSNQRTEALGRKTSNGGRI", "length": 584, "header": "sp|P34072-1|MKS1_YEAST Isoform 1 of Negative regulator of RAS-cAMP pathway OS=Saccharomyces cerevisiae S288C OX=559292 GN=MKS1 PE=1 SV=2 CANONICAL=P34072-1" }, "isoforms": [ { "isoform_ac": "P34072-1", "url": "", "sequence": { "sequence": "MSREAFDVPNIGTNKFLKVTPNLFTPERLNLFDDVELYLTLIKASKCVEQGERLHNISWRILNKAVLKEHNINRSKKRDGVKNIYYVLNPNNKQPIKPKQAAVKQPPLQKANLPPTTAKQNVLTRPMTSPAIAQGAHDRSLDNPNSTNNDVKNDVAPNRQFSKSTTSGLFSNFADKYQKMKNVNHVANKEEPQTIITGFDTSTVITKKPLQSRRSRSPFQHIGDMNMNCIDNETSKSTSPTLENMGSRKSSFPQKESLFGRPRSYKNDQNGQLSLSKTSSRKGKNKIFFSSEDEDSDWDSVSNDSEFYADEDDEEYDDYNEEEADQYYRRQWDKLLFAKNQQNLDSTKSSVSSANTINSNTSHDPVRKSLLSGLFLSEANSNSNNHNTAHSEYASKHVSPTPQSSHSNIGPQPQQNPPSANGIKQQKPSLKTSNVTALASLSPPQPSNNERLSMDIQKDFKTDNESNHLYESNAPLTAQTILPTALSTHMFLPNNIHQQRMAIATGSNTRHRFSRRQSMDIPSKNRNTGFLKTRMEISEEEKMVRTISRLDNTSIANSNGNGNDDTSNQRTEALGRKTSNGGRI", "length": 584, "header": "sp|P34072-1|MKS1_YEAST Isoform 1 of Negative regulator of RAS-cAMP pathway OS=Saccharomyces cerevisiae S288C OX=559292 GN=MKS1 PE=1 SV=2 CANONICAL=P34072-1" }, "locus": { "chromosome": "XIV", "start_pos": 485307, "end_pos": 483556, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YNL076W_mRNA", "url": "https://www.ensembl.org/id/YNL076W_mRNA" }, { "database": "Ensembl Peptide", "id": "YNL076W", "url": "https://www.ensembl.org/id/YNL076W" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 140, "start_aa": "Ser", "end_pos": 140, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser140", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 146, "start_aa": "Ser", "end_pos": 146, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser146", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 349, "start_aa": "Ser", "end_pos": 349, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser349", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 350, "start_aa": "Ser", "end_pos": 350, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser350", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 352, "start_aa": "Ser", "end_pos": 352, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser352", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 353, "start_aa": "Ser", "end_pos": 353, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser353", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 359, "start_aa": "Ser", "end_pos": 359, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser359", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 362, "start_aa": "Ser", "end_pos": 362, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser362", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P34072", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P34072" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] } ], "phosphorylation": [ { "start_pos": 146, "end_pos": 146, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser146" }, { "start_pos": 164, "end_pos": 164, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ], "site_lbl": "Ser164" }, { "start_pos": 165, "end_pos": 165, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" } ], "site_lbl": "Thr165" }, { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" } ], "site_lbl": "Thr166" }, { "start_pos": 217, "end_pos": 217, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Ser217" }, { "start_pos": 237, "end_pos": 237, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser237" }, { "start_pos": 239, "end_pos": 239, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser239" }, { "start_pos": 241, "end_pos": 241, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ], "site_lbl": "Thr241" }, { "start_pos": 247, "end_pos": 247, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser247" }, { "start_pos": 250, "end_pos": 250, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ], "site_lbl": "Ser250" }, { "start_pos": 251, "end_pos": 251, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser251" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" } ], "site_lbl": "Thr25" }, { "start_pos": 264, "end_pos": 264, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "17287358", "url": "https://glygen.org/publication/PubMed/17287358" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser264" }, { "start_pos": 265, "end_pos": 265, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" } ], "site_lbl": "Tyr265" }, { "start_pos": 274, "end_pos": 274, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser274" }, { "start_pos": 276, "end_pos": 276, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" } ], "site_lbl": "Ser276" }, { "start_pos": 399, "end_pos": 399, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser399" }, { "start_pos": 419, "end_pos": 419, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser419" }, { "start_pos": 429, "end_pos": 429, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser429" }, { "start_pos": 440, "end_pos": 440, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser440" }, { "start_pos": 442, "end_pos": 442, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser442" }, { "start_pos": 507, "end_pos": 507, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser507" }, { "start_pos": 509, "end_pos": 509, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Thr509" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser518" }, { "start_pos": 554, "end_pos": 554, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser554" }, { "start_pos": 558, "end_pos": 558, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" }, { "database": "SGD", "id": "P34072", "url": "https://www.yeastgenome.org/locus/P34072" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser558" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005-03", "authors": "Gruhler Albrecht, Olsen Jesper V, Mohammed Shabaz, Mortensen Peter, Faergeman Nils J, Mann Matthias, Jensen Ole N", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" } ] }, { "title": "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Chi An, Huttenhower Curtis, Geer Lewis Y, Coon Joshua J, Syka John E P, Bai Dina L, Shabanowitz Jeffrey, Burke Daniel J, Troyanskaya Olga G, Hunt Donald F", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "17287358", "url": "https://glygen.org/publication/PubMed/17287358" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Characterization of the rapamycin-sensitive phosphoproteome reveals that Sch9 is a central coordinator of protein synthesis.", "journal": "Genes & development", "date": "2009-08-15", "authors": "Huber Alexandre, Bodenmiller Bernd, Uotila Aino, Stahl Michael, Wanka Stefanie, Gerrits Bertran, Aebersold Ruedi, Loewith Robbie", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" }, { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "A global protein kinase and phosphatase interaction network in yeast.", "journal": "Science (New York, N.Y.)", "date": "2010-05-21", "authors": "Breitkreutz Ashton, Choi Hyungwon, Sharom Jeffrey R, Boucher Lorrie, Neduva Victor, Larsen Brett, Lin Zhen-Yuan, Breitkreutz Bobby-Joe, Stark Chris, Liu Guomin, Ahn Jessica, Dewar-Darch Danielle, Reguly Teresa, Tang Xiaojing, Almeida Ricardo, Qin Zhaohui Steve, Pawson Tony, Gingras Anne-Claude, Nesvizhskii Alexey I, Tyers Mike", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" } ] }, { "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.", "journal": "Molecular biology of the cell", "date": "2010-10-01", "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P34072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34072" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Identification of novel O-GlcNAc transferase substrates using yeast cells expressing OGT.", "journal": "The Journal of general and applied microbiology", "date": "2021-04-16", "authors": "Li Feng, Yang Ganglong, Tachikawa Hiroyuki, Shao Kankai, Yang Yan, Gao Xiao-Dong, Nakanishi Hideki", "evidence": [ { "database": "O-GlcNAc Database", "id": "P34072", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P34072" }, { "database": "O-GlcNAc Atlas", "id": "P34072", "url": "https://oglcnac.org/atlas/detail/P34072" } ], "reference": [ { "type": "PubMed", "id": "33229814", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "title": "Characterization of the MKS1 gene, a new negative regulator of the Ras-cyclic AMP pathway in Saccharomyces cerevisiae.", "journal": "Mol. Gen. Genet.", "date": "1993", "authors": "Matsuura A., Anraku Y.", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "reference": [ { "type": "PubMed", "id": "8386801", "url": "https://glygen.org/publication/PubMed/8386801" } ] }, { "title": "Sequencing a cosmid clone of Saccharomyces cerevisiae chromosome XIV reveals 12 new open reading frames (ORFs) and an ancient duplication of six ORFs.", "journal": "Yeast", "date": "1996", "authors": "Philippsen P., Poehlmann R.", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "reference": [ { "type": "PubMed", "id": "8701611", "url": "https://glygen.org/publication/PubMed/8701611" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] } ], "pathway": [ { "id": "sce:YNL076W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL076W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "pmid": "" }, { "name": "regulation of nitrogen utilization", "id": "GO:0006808", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006808", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "pmid": "" }, { "name": "mitochondria-nucleus signaling pathway", "id": "GO:0031930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031930", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "pmid": "" }, { "name": "regulation of pseudohyphal growth", "id": "GO:2000220", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000220", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P34072", "url": "https://www.uniprot.org/uniprot/P34072" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 232, "end_pos": 234, "annotation": "n_glycosylation_sequon" }, { "start_pos": 303, "end_pos": 305, "annotation": "n_glycosylation_sequon" }, { "start_pos": 360, "end_pos": 362, "annotation": "n_glycosylation_sequon" }, { "start_pos": 434, "end_pos": 436, "annotation": "n_glycosylation_sequon" }, { "start_pos": 464, "end_pos": 466, "annotation": "n_glycosylation_sequon" }, { "start_pos": 552, "end_pos": 554, "annotation": "n_glycosylation_sequon" }, { "start_pos": 56, "end_pos": 58, "annotation": "n_glycosylation_sequon" }, { "start_pos": 73, "end_pos": 75, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 26 }, { "field": "total_sites", "count": 26 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }