{
    "uniprot_canonical_ac": "P33893-1",
    "uniprot_ac": "P33893",
    "uniprot_id": "GATB_YEAST",
    "mass": {
        "chemical_mass": 61869.0,
        "monoisotopic_mass": 61869.0
    },
    "refseq": {
        "ac": "NP_009473",
        "name": "glutamyl-tRNA(Gln) amidotransferase subunit PET112",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009473"
    },
    "gene_names": [
        {
            "name": "PET112",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P33893",
            "id": "P33893"
        },
        {
            "name": "PET112",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009473",
            "id": "NP_009473"
        },
        {
            "name": "YBL0724",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P33893",
            "id": "P33893"
        }
    ],
    "protein_names": [
        {
            "name": "Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P33893"
        },
        {
            "name": "6.3.5.-",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P33893"
        },
        {
            "name": "Cytochrome c oxidase assembly factor PET112",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P33893"
        },
        {
            "name": "Glu-AdT subunit B",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P33893"
        },
        {
            "name": "glutamyl-tRNA(Gln) amidotransferase subunit PET112",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009473",
            "id": "NP_009473"
        }
    ],
    "function": [
        {
            "annotation": "Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893#function"
                },
                {
                    "database": "PubMed",
                    "id": "19417106",
                    "url": "https://glygen.org/publication/PubMed/19417106"
                },
                {
                    "database": "UniProtKB",
                    "id": "MF_03147",
                    "url": "https://www.uniprot.org/uniprot/MF_03147#function"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0050700",
            "recommended_name": {
                "id": "DOID:0050700",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0050700",
                "name": "cardiomyopathy",
                "description": "A heart disease and a myopathy that is characterized by deterioration of the function of the heart muscle."
            },
            "synonyms": [
                {
                    "id": "DOID:0050700",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0050700",
                    "name": "Cardiomyopathies",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "0050700",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0050700"
                }
            ]
        },
        {
            "disease_id": "DOID:0112119",
            "recommended_name": {
                "id": "DOID:0112119",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0112119",
                "name": "combined oxidative phosphorylation deficiency 41",
                "description": "A combined oxidative phosphorylation deficiency that has_material_basis_in homozygous or compound heterozygous mutation in the GATB gene on chromosome 4q31.3."
            },
            "synonyms": [
                {
                    "id": "DOID:0112119",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0112119",
                    "name": "COXPD41",
                    "description": ""
                },
                {
                    "id": "MONDO:0030007",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0030007",
                    "name": "combined oxidative phosphorylation deficiency 41",
                    "description": ""
                },
                {
                    "id": "MONDO:0030007",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0030007",
                    "name": "COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 41",
                    "description": ""
                },
                {
                    "id": "MONDO:0030007",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0030007",
                    "name": "COXPD41",
                    "description": ""
                },
                {
                    "id": "MONDO:0030007",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0030007",
                    "name": "combined oxidative phosphorylation deficiency 41",
                    "description": ""
                },
                {
                    "id": "MIM:618838",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/618838",
                    "name": "Combined oxidative phosphorylation deficiency 41",
                    "description": "Combined oxidative phosphorylation deficiency 41"
                }
            ],
            "evidence": [
                {
                    "id": "0112119",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0112119"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "PET112",
            "url": "https://www.uniprot.org/uniprot/P33893",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "852198",
            "url": "https://www.ncbi.nlm.nih.gov/gene/852198",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P33893",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P33893*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR003789",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003789",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR004413",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR004413",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR006075",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006075",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR014746",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR014746",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017958",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017958",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017959",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017959",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR018027",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR018027",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR023168",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR023168",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YBL080C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBL080C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "ARKWWMG",
            "url": "https://omabrowser.org/oma/group/ARKWWMG/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5474932at2759",
            "url": "http://www.orthodb.org/?query=5474932at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11659",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11659",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11659:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11659:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4N0H",
            "url": "https://www.rcsb.org/structure/4N0H",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4N0I",
            "url": "https://www.rcsb.org/structure/4N0I",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF02637",
            "url": "http://pfam.xfam.org/family/PF02637",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF02934",
            "url": "http://pfam.xfam.org/family/PF02934",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P33893",
            "url": "http://purl.obolibrary.org/obo/PR_P33893",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_009473",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009473",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000000176",
            "url": "https://www.yeastgenome.org/locus/S000000176",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P33893",
            "url": "https://www.uniprot.org/uniprot/P33893",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P33893-1",
            "url": "https://www.uniprot.org/uniprot/P33893-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MLRLARFYSLARTKAIHSHGAPFRPEYALKCGLEIHTQLNTKNKLFSQSTNSATSLVDAPNHHTSYYDIALPGTQPVLNLEAILFAMKLSLALGSQVNSISQFDRKHYFYGDQPQGYQLTQHYRPFARGGKINLSKELDDIDESAKEIGILQLQIEQDTGKSHYTETDKDVITLVDLNRSNVPLIELVTKPDFSDIKQVRAFIKKYQNLVRHLHISSGDLETGAMRVDVNLSINEYARVELKNLPNTSSIINAIKYEYQRQVELISVGDTSSLMEPETRGWTGSSTVKLRSKETTIDYRYMPDPELPYINLAPDVISGVRGLMPQLPDDIMRILMKKPYQLSLKDAKILTYNSNQNDMYNHEALRSYYLDTFREFSKLAGERSNAKLPTNWIIHEFLGDLNKLQIPLAKAKEILPPPVFAQFLKLLHEEVISATSGKMLLFHILENFEQSNCQDLSIPDFSKLIEKFELHAINQVDPQELMDLCNDVIAQHTDDTFIRNLVTGKKKSSLKFLIGQGMRRSQGRIKANEFEKKFKEILNIQW",
        "length": 541,
        "header": "sp|P33893-1|GATB_YEAST Isoform 1 of Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial  OS=Saccharomyces cerevisiae S288C OX=559292 GN=PET112 PE=1 SV=3 CANONICAL=P33893-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P33893-1",
            "url": "",
            "sequence": {
                "sequence": "MLRLARFYSLARTKAIHSHGAPFRPEYALKCGLEIHTQLNTKNKLFSQSTNSATSLVDAPNHHTSYYDIALPGTQPVLNLEAILFAMKLSLALGSQVNSISQFDRKHYFYGDQPQGYQLTQHYRPFARGGKINLSKELDDIDESAKEIGILQLQIEQDTGKSHYTETDKDVITLVDLNRSNVPLIELVTKPDFSDIKQVRAFIKKYQNLVRHLHISSGDLETGAMRVDVNLSINEYARVELKNLPNTSSIINAIKYEYQRQVELISVGDTSSLMEPETRGWTGSSTVKLRSKETTIDYRYMPDPELPYINLAPDVISGVRGLMPQLPDDIMRILMKKPYQLSLKDAKILTYNSNQNDMYNHEALRSYYLDTFREFSKLAGERSNAKLPTNWIIHEFLGDLNKLQIPLAKAKEILPPPVFAQFLKLLHEEVISATSGKMLLFHILENFEQSNCQDLSIPDFSKLIEKFELHAINQVDPQELMDLCNDVIAQHTDDTFIRNLVTGKKKSSLKFLIGQGMRRSQGRIKANEFEKKFKEILNIQW",
                "length": 541,
                "header": "sp|P33893-1|GATB_YEAST Isoform 1 of Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial  OS=Saccharomyces cerevisiae S288C OX=559292 GN=PET112 PE=1 SV=3 CANONICAL=P33893-1"
            },
            "locus": {
                "chromosome": "II",
                "start_pos": 74695,
                "end_pos": 73073,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YBL080C_mRNA",
                        "url": "https://www.ensembl.org/id/YBL080C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YBL080C",
                        "url": "https://www.ensembl.org/id/YBL080C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "enzyme"
    ],
    "publication": [
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "The proteome of Saccharomyces cerevisiae mitochondria.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2003",
            "authors": "Sickmann A., Zahedi R.P., Rehling P., Chacinska A., Guiard B., Meyer H.E., Meisinger C., Reinders J., Pfanner N., Joppich C., Perschil I., Schoenfisch B., Wagner Y.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14576278",
                    "url": "https://glygen.org/publication/PubMed/14576278"
                }
            ]
        },
        {
            "title": "Yeast mitochondrial Gln-tRNA(Gln) is generated by a GatFAB-mediated transamidation pathway involving Arc1p-controlled subcellular sorting of cytosolic GluRS.",
            "journal": "Genes Dev.",
            "date": "2009",
            "authors": "Martin R.P., Kern D., Senger B., Becker H.D., Braye M., Frechin M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19417106",
                    "url": "https://glygen.org/publication/PubMed/19417106"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II.",
            "journal": "Yeast",
            "date": "1995",
            "authors": "Gassenhuber J., Obermaier B., Domdey H., Piravandi E.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7502586",
                    "url": "https://glygen.org/publication/PubMed/7502586"
                }
            ]
        },
        {
            "title": "Complete DNA sequence of yeast chromosome II.",
            "journal": "EMBO J.",
            "date": "1994",
            "authors": "Gassenhuber J., Mewes H.-W., Obermaier B., Stucka R., Rose M., Wagner G., Boles E., Brueckner M., Jacquet M., Rieger M., Mueller S., Molemans F., Zagulski M., Brandt T., Christiansen C., Barthe C., Feldmann H., Kleine K., Cziepluch C., Fiers W., Mallet L., Jauniaux J.-C., Dubois E., Andre B., Li Z.Y., Koetter P., Hein C., Entian K.-D., Slonimski P.P., Vetter I., Nasr F., Louis E.J., Delaveau T., Hollenberg C.P., Contreras R., Domdey H., Pohl T.M., Brendel M., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Dujon B., El Bakkoury M., Feuermann M., Glansdorff N., Goffeau A., Grivell L.A., Herbert C.J., Jacq C., Mannhaupt G., Messenguy F., Miosga T., Perea J., Pierard A., Potier S., Proft M., Schaaff-Gerstenschlaeger I., Scherens B., Souciet J.-L., Steensma H.Y., Vissers S., Zimmermann F.K., Aljinovic G., Duesterhus S., Jonniaux J.-L., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Urrestarazu L.A., Vierendeels F., de Wergifosse P., Aigle M., Baclet M.C., Baur A., Biteau N., Demolis N., Fobo G.M., Fritz C., Holmstroem K., Kallesoee T., Kiesau P., Korol S., Liebl S., Logghe M., Lohan A.J.E., Maat M.J., Piravandi E., Pohl F.M., Schwarzlose C., Smits P.H.M., Van Dyck L., Vassarotti A., Wolfe K.H., de Haan M., van der Aart Q.J.M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7813418",
                    "url": "https://glygen.org/publication/PubMed/7813418"
                }
            ]
        },
        {
            "title": "PET112, a Saccharomyces cerevisiae nuclear gene required to maintain rho+ mitochondrial DNA.",
            "journal": "Curr. Genet.",
            "date": "1994",
            "authors": "Mulero J.J., Fox T.D., Rosenthal J.K.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33893",
                    "url": "https://www.uniprot.org/uniprot/P33893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8082172",
                    "url": "https://glygen.org/publication/PubMed/8082172"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YBL080C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBL080C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "O75879-1",
            "protein_name": "Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial",
            "gene_name": "GATB",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MAAPMLRWGCRGRRWAFARVDGGSCHRRGAPTGSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLIYGVCAGKKQSQVIPKTVRIKQIQLEQDSGKSLHDNLRSQTLIDLNRAGVGLLEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSIRFLAKAIDYEIQRQINELENGGEILNETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADPQQVINIDQIRETLPELPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPKKVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSSAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLSL",
                "length": 557
            },
            "evidence": [
                {
                    "id": "P33893",
                    "url": "https://omabrowser.org/oma/group/P33893/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q99JT1-1",
            "protein_name": "Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial",
            "gene_name": "Gatb",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MAAPMLRLGFPGRRWALTWLDGGSRHRSGSQTGPTSNWARRQSSVAQPSLHTAQKPRKGEHKWAAVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVSYFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYSDLPAGYQITQQRLPIAANGHLTYCIYLGKKPSQVTTKTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIGLLEVVLEPDLCCGEEAALAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSLRFLAKAIDYEIQRQITELENGGEILNETRSFDYKLGCTMPMRDKEGKQDYRFMPEPNLPPLVLYDDTSLPRGADSQQVINIDQLRDMLPELPSATRERLVQQYGMLPEHSFALLNEVGLLEFFQNVIKETRTEPKKVTNWVLNTFLCYLKQQNLAVSESPVTPSALAELLNLLDRKAISSSAAKQVFEELWKGEGKTAAQIVSEQQLELMQDQEALEKLCQTTIDGHPQVVMDVKKRNPKAINKLIGLVRKASHSRADPALIKKILERKLSL",
                "length": 557
            },
            "evidence": [
                {
                    "id": "P33893",
                    "url": "https://omabrowser.org/oma/group/P33893/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q9VCD0-1",
            "protein_name": "Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial",
            "gene_name": "GatB",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MHYSIIRKLVTAPKLANVPKRKWKSVVGLEVHAQIASASKLFSGSGTSFGAPLNSSVAYFDASIPGTLPVLNRKCVESGIKTSLALGCRVNEVSMFDRKHYFYADLPNGYQITQQRAALANDGKMTFPVITPGKKVYYKTAKLLQLQLEQDSGKSLHDDYLKRSLVDLNRAGLPLMELVFAPDLETGEEAASLVKELILILRRLQTCSCKMEEGALRVDANISIHQEGDPLGVRTEVKNIGSVRSISQAITYEINRQLETVANGGVITNETRNWDAENRRTVAMRDKEVLQDYRFMPEPNLPPLHVNLKPGSMSTEDLLSVAALSEEIPELPEDTRQRLVEQHNLNAETAIILVNEPILLDHFLSITRSLSDLPNKVICNFLINDLLTYCNKLNLDVEDCSIKADDLKDILMSLHAELINLQAARQLVDLLHNNPKAKVSELIELHSLQQICSPDEIENLCQLAIANQAKAVEQYQKGKAKALFAIAGEVAKLSSQKANMKLVVQRLEKLLKPTNK",
                "length": 516
            },
            "evidence": [
                {
                    "id": "P33893",
                    "url": "https://omabrowser.org/oma/group/P33893/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "ATP binding",
                        "id": "GO:0005524",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33893",
                                "url": "https://www.uniprot.org/uniprot/P33893"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity",
                        "id": "GO:0050567",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050567",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33893",
                                "url": "https://www.uniprot.org/uniprot/P33893"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "mitochondrion",
                        "id": "GO:0005739",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33893",
                                "url": "https://www.uniprot.org/uniprot/P33893"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "glutamyl-tRNA(Gln) amidotransferase complex",
                        "id": "GO:0030956",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030956",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33893",
                                "url": "https://www.uniprot.org/uniprot/P33893"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "mitochondrial translation",
                        "id": "GO:0032543",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032543",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33893",
                                "url": "https://www.uniprot.org/uniprot/P33893"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "glutaminyl-tRNAGln biosynthesis via transamidation",
                        "id": "GO:0070681",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070681",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33893",
                                "url": "https://www.uniprot.org/uniprot/P33893"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 133,
            "end_pos": 135,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 178,
            "end_pos": 180,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 230,
            "end_pos": 232,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 246,
            "end_pos": 248,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [
        {
            "id": "17521",
            "name": "",
            "equation": "ATP + H2O + L-glutamine + L-glutamyl-tRNA(Gln) = ADP + H(+) + L-glutamate + L-glutaminyl-tRNA(Gln) + phosphate",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "D3ZY68-1",
                "Q5FWT5-1",
                "A0A8I6AHE4-1",
                "O75879-1",
                "O43716-1",
                "Q9H0R6-1",
                "Q8CBY0-1",
                "Q99JT1-1",
                "Q9CZN8-1",
                "P33893-1",
                "Q03557-1",
                "P53260-1",
                "Q54L63-1",
                "Q54PU2-1",
                "Q55ER8-1",
                "Q86BL4-1",
                "Q9VE09-1",
                "Q9VCD0-1"
            ],
            "evidence": [
                {
                    "id": "17521",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/17521"
                }
            ]
        }
    ],
    "reaction_participants": [],
    "reaction_enzymes": [
        {
            "uniprot_ac": "A0A8I6AHE4",
            "gene_name": "Gatb",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AHE4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AHE4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZY68",
            "gene_name": "Gatc",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZY68",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZY68"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O43716",
            "gene_name": "GATC",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O43716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43716"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O75879",
            "gene_name": "GATB",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O75879",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75879"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P33893",
            "gene_name": "PET112",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P33893",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P33893"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P53260",
            "gene_name": "GTF1",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P53260",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P53260"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03557",
            "gene_name": "HER2",
            "activity": [
                {
                    "ec_number": "6.3.5.7",
                    "activity": "ATP + H2O + L-glutamine + L-glutamyl-tRNA(Gln) = ADP + H(+) + L-glutamate + L-glutaminyl-tRNA(Gln) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q03557",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03557"
                        }
                    ]
                },
                {
                    "ec_number": "6.3.5.7",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03557",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03557"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54L63",
            "gene_name": "gatA",
            "activity": [
                {
                    "ec_number": "6.3.5.7",
                    "activity": "ATP + H2O + L-glutamine + L-glutamyl-tRNA(Gln) = ADP + H(+) + L-glutamate + L-glutaminyl-tRNA(Gln) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q54L63",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54L63"
                        }
                    ]
                },
                {
                    "ec_number": "6.3.5.7",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54L63",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54L63"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54PU2",
            "gene_name": "gatc",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54PU2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54PU2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q55ER8",
            "gene_name": "",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q55ER8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q55ER8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5FWT5",
            "gene_name": "Qrsl1",
            "activity": [
                {
                    "ec_number": "6.3.5.7",
                    "activity": "ATP + H2O + L-glutamine + L-glutamyl-tRNA(Gln) = ADP + H(+) + L-glutamate + L-glutaminyl-tRNA(Gln) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q5FWT5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5FWT5"
                        }
                    ]
                },
                {
                    "ec_number": "6.3.5.7",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5FWT5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5FWT5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q86BL4",
            "gene_name": "GatC",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q86BL4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q86BL4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8CBY0",
            "gene_name": "Gatc",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8CBY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CBY0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q99JT1",
            "gene_name": "Gatb",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q99JT1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99JT1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9CZN8",
            "gene_name": "Qrsl1",
            "activity": [
                {
                    "ec_number": "6.3.5.7",
                    "activity": "ATP + H2O + L-glutamine + L-glutamyl-tRNA(Gln) = ADP + H(+) + L-glutamate + L-glutaminyl-tRNA(Gln) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q9CZN8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9CZN8"
                        }
                    ]
                },
                {
                    "ec_number": "6.3.5.7",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9CZN8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9CZN8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9H0R6",
            "gene_name": "QRSL1",
            "activity": [
                {
                    "ec_number": "6.3.5.7",
                    "activity": "ATP + H2O + L-glutamine + L-glutamyl-tRNA(Gln) = ADP + H(+) + L-glutamate + L-glutaminyl-tRNA(Gln) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q9H0R6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9H0R6"
                        }
                    ]
                },
                {
                    "ec_number": "6.3.5.7",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9H0R6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9H0R6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VCD0",
            "gene_name": "GatB",
            "activity": [
                {
                    "ec_number": "6.3.5.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VCD0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VCD0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VE09",
            "gene_name": "GatA",
            "activity": [
                {
                    "ec_number": "6.3.5.7",
                    "activity": "ATP + H2O + L-glutamine + L-glutamyl-tRNA(Gln) = ADP + H(+) + L-glutamate + L-glutaminyl-tRNA(Gln) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q9VE09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VE09"
                        }
                    ]
                },
                {
                    "ec_number": "6.3.5.7",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VE09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VE09"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}