{ "uniprot_canonical_ac": "P33312-1", "uniprot_ac": "P33312", "uniprot_id": "RIB7_YEAST", "mass": { "chemical_mass": 27116.0, "monoisotopic_mass": 27116.0 }, "refseq": { "ac": "NP_009711", "name": "2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009711" }, "gene_names": [ { "name": "RIB7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P33312", "id": "P33312" }, { "name": "RIB7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009711", "id": "NP_009711" }, { "name": "YBR1203", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P33312", "id": "P33312" } ], "protein_names": [ { "name": "2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate reductase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P33312" }, { "name": "1.1.1.302", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P33312" }, { "name": "2,5-diamino-6-(5-phospho-D-ribosylamino)pyrimidin-4(3H)-one reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P33312" }, { "name": "2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009711", "id": "NP_009711" }, { "name": "2,5-diamino-6-ribitylamino-4(3H)-pyrimidinone 5'-phosphate synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P33312" }, { "name": "DARIPP synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P33312" }, { "name": "DAROPP reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P33312" }, { "name": "DARP reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P33312" } ], "function": [ { "annotation": "Catalyzes an early step in riboflavin biosynthesis, the NADPH-dependent reduction of the ribose side chain of 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate, yielding 2,5-diamino-6-ribitylamino-4(3H)-pyrimidinone 5'-phosphate.", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312#function" }, { "database": "PubMed", "id": "4555411", "url": "https://glygen.org/publication/PubMed/4555411" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "common_name": "Yeast" } ], "gene": [ { "name": "RIB7", "url": "https://www.uniprot.org/uniprot/P33312", "locus": {} } ], "crossref": [ { "id": "852450", "url": "https://www.ncbi.nlm.nih.gov/gene/852450", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P33312", "url": "https://www.ebi.ac.uk/intact/interactors/id:P33312*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002734", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002734", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011549", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011549", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YBR153W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBR153W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HYLRYHH", "url": "https://omabrowser.org/oma/group/HYLRYHH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "53917at2759", "url": "http://www.orthodb.org/?query=53917at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR38011", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR38011", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR38011:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR38011:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4HA7", "url": "https://www.rcsb.org/structure/4HA7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4HA9", "url": "https://www.rcsb.org/structure/4HA9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01872", "url": "http://pfam.xfam.org/family/PF01872", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P33312", "url": "http://purl.obolibrary.org/obo/PR_P33312", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_009711", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009711", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000000357", "url": "https://www.yeastgenome.org/locus/S000000357", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P33312-1", "url": "https://www.uniprot.org/uniprot/P33312-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLTPLCEDLPQFLQNYLPNAGQTENTIVPFVTLTYAQSLDARVSRGPGVRTTISHPETKTMTHYLRHHHDGILVGSGTVLADNPGLNCKWGPDPAANSPRPIIIDTKQKWRFDGSKMQELFIKRQGKPPIVVVTSEPIIKEQHVDYAICPINDTTKLVDWKKLFEILKEEFNIRSVMVEGGANVINQLLLRSDIVNSLIITIGSTFLGSSGTEVSPPQTVNLKDMSWWKGITDVVLCARLADD", "length": 244, "header": "sp|P33312-1|RIB7_YEAST Isoform 1 of 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate reductase OS=Saccharomyces cerevisiae S288C OX=559292 GN=RIB7 PE=1 SV=1 CANONICAL=P33312-1" }, "isoforms": [ { "isoform_ac": "P33312-1", "url": "", "sequence": { "sequence": "MSLTPLCEDLPQFLQNYLPNAGQTENTIVPFVTLTYAQSLDARVSRGPGVRTTISHPETKTMTHYLRHHHDGILVGSGTVLADNPGLNCKWGPDPAANSPRPIIIDTKQKWRFDGSKMQELFIKRQGKPPIVVVTSEPIIKEQHVDYAICPINDTTKLVDWKKLFEILKEEFNIRSVMVEGGANVINQLLLRSDIVNSLIITIGSTFLGSSGTEVSPPQTVNLKDMSWWKGITDVVLCARLADD", "length": 244, "header": "sp|P33312-1|RIB7_YEAST Isoform 1 of 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate reductase OS=Saccharomyces cerevisiae S288C OX=559292 GN=RIB7 PE=1 SV=1 CANONICAL=P33312-1" }, "locus": { "chromosome": "II", "start_pos": 548191, "end_pos": 547460, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YBR153W_mRNA", "url": "https://www.ensembl.org/id/YBR153W_mRNA" }, { "database": "Ensembl Peptide", "id": "YBR153W", "url": "https://www.ensembl.org/id/YBR153W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Biosynthesis of riboflavine in Saccharomyces cerevisiae: the role of genes rib 1 and rib 7.", "journal": "J. Bacteriol.", "date": "1972", "authors": "Bacher A., Oltmanns O.", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "reference": [ { "type": "PubMed", "id": "4555411", "url": "https://glygen.org/publication/PubMed/4555411" } ] }, { "title": "Complete DNA sequence of yeast chromosome II.", "journal": "EMBO J.", "date": "1994", "authors": "Gassenhuber J., Mewes H.-W., Obermaier B., Stucka R., Rose M., Wagner G., Boles E., Brueckner M., Jacquet M., Rieger M., Mueller S., Molemans F., Zagulski M., Brandt T., Christiansen C., Barthe C., Feldmann H., Kleine K., Cziepluch C., Fiers W., Mallet L., Jauniaux J.-C., Dubois E., Andre B., Li Z.Y., Koetter P., Hein C., Entian K.-D., Slonimski P.P., Vetter I., Nasr F., Louis E.J., Delaveau T., Hollenberg C.P., Contreras R., Domdey H., Pohl T.M., Brendel M., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Dujon B., El Bakkoury M., Feuermann M., Glansdorff N., Goffeau A., Grivell L.A., Herbert C.J., Jacq C., Mannhaupt G., Messenguy F., Miosga T., Perea J., Pierard A., Potier S., Proft M., Schaaff-Gerstenschlaeger I., Scherens B., Souciet J.-L., Steensma H.Y., Vissers S., Zimmermann F.K., Aljinovic G., Duesterhus S., Jonniaux J.-L., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Urrestarazu L.A., Vierendeels F., de Wergifosse P., Aigle M., Baclet M.C., Baur A., Biteau N., Demolis N., Fobo G.M., Fritz C., Holmstroem K., Kallesoee T., Kiesau P., Korol S., Liebl S., Logghe M., Lohan A.J.E., Maat M.J., Piravandi E., Pohl F.M., Schwarzlose C., Smits P.H.M., Van Dyck L., Vassarotti A., Wolfe K.H., de Haan M., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "reference": [ { "type": "PubMed", "id": "7813418", "url": "https://glygen.org/publication/PubMed/7813418" } ] }, { "title": "Sequence of a 4.8 kb fragment of Saccharomyces cerevisiae chromosome II including three essential open reading frames.", "journal": "Yeast", "date": "1993", "authors": "Rose M., Boles E., Miosga T., Schaaff-Gerstenschlaeger I., Zimmermann F.K., Baur A.", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "reference": [ { "type": "PubMed", "id": "8488729", "url": "https://glygen.org/publication/PubMed/8488729" } ] } ], "pathway": [ { "id": "sce:YBR153W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBR153W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "riboflavin biosynthetic process", "id": "GO:0009231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009231", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "NADP binding", "id": "GO:0050661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050661", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "pmid": "" }, { "name": "5-amino-6-(5-phosphoribosylamino)uracil reductase activity", "id": "GO:0008703", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008703", "evidence": [ { "database": "UniProtKB", "id": "P33312", "url": "https://www.uniprot.org/uniprot/P33312" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 153, "end_pos": 155, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "27274", "name": "", "equation": "2,5-diamino-6-(1-D-ribitylamino)pyrimidin-4(3H)-one 5'-phosphate + NAD(+) = 2,5-diamino-6-(1-D-ribosylamino)pyrimidin-4(3H)-one 5'-phosphate + H(+) + NADH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P33312-1" ], "evidence": [ { "id": "27274", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/27274" } ] }, { "id": "27278", "name": "", "equation": "2,5-diamino-6-(1-D-ribitylamino)pyrimidin-4(3H)-one 5'-phosphate + NADP(+) = 2,5-diamino-6-(1-D-ribosylamino)pyrimidin-4(3H)-one 5'-phosphate + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P33312-1" ], "evidence": [ { "id": "27278", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/27278" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P33312", "gene_name": "RIB7", "activity": [ { "ec_number": "1.1.1.302", "activity": "2,5-diamino-6-(1-D-ribitylamino)pyrimidin-4(3H)-one 5'-phosphate + NAD(+) = 2,5-diamino-6-(1-D-ribosylamino)pyrimidin-4(3H)-one 5'-phosphate + H(+) + NADH.", "evidence": [ { "id": "P33312", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33312" } ] }, { "ec_number": "1.1.1.302", "activity": "", "evidence": [ { "id": "P33312", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33312" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }