{
    "uniprot_canonical_ac": "P33309-1",
    "uniprot_ac": "P33309",
    "uniprot_id": "DOM34_YEAST",
    "mass": {
        "chemical_mass": 44058.0,
        "monoisotopic_mass": 44058.0
    },
    "refseq": {
        "ac": "NP_014397",
        "name": "ribosome dissociation factor DOM34",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014397"
    },
    "gene_names": [
        {
            "name": "DOM34",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P33309",
            "id": "P33309"
        },
        {
            "name": "DOM34",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014397",
            "id": "NP_014397"
        },
        {
            "name": "N2016",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P33309",
            "id": "P33309"
        }
    ],
    "protein_names": [
        {
            "name": "Protein DOM34",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P33309"
        },
        {
            "name": "ribosome dissociation factor DOM34",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014397",
            "id": "NP_014397"
        }
    ],
    "function": [
        {
            "annotation": "Component of the Dom34-Hbs1 complex, a complex that recognizes stalled ribosomes and triggers the No-Go Decay (NGD) pathway (PubMed:16554824, PubMed:17889667, PubMed:18180287, PubMed:19420139, PubMed:20947765, PubMed:21102444). In the Dom34-Hbs1 complex, DOM34 recognizes ribosomes stalled at the 3' end of an mRNA and engages stalled ribosomes by destabilizing mRNA in the mRNA channel (PubMed:16554824, PubMed:20947765). Following ribosome-binding, the Dom34-Hbs1 complex promotes the disassembly of stalled ribosomes, followed by degradation of damaged mRNAs as part of the NGD pathway (PubMed:20947765). The Dom34-Hbs1 complex is also involved in non-functional rRNA decay (PubMed:21102444).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309#function"
                },
                {
                    "database": "PubMed",
                    "id": "20947765",
                    "url": "https://glygen.org/publication/PubMed/20947765"
                },
                {
                    "database": "PubMed",
                    "id": "18180287",
                    "url": "https://glygen.org/publication/PubMed/18180287"
                },
                {
                    "database": "PubMed",
                    "id": "21102444",
                    "url": "https://glygen.org/publication/PubMed/21102444"
                },
                {
                    "database": "PubMed",
                    "id": "17889667",
                    "url": "https://glygen.org/publication/PubMed/17889667"
                },
                {
                    "database": "PubMed",
                    "id": "16554824",
                    "url": "https://glygen.org/publication/PubMed/16554824"
                },
                {
                    "database": "PubMed",
                    "id": "19420139",
                    "url": "https://glygen.org/publication/PubMed/19420139"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [
        {
            "start_pos": 174,
            "end_pos": 176,
            "sequence_org": "KKK",
            "sequence_mut": "AAA",
            "comment": "Reduced No-Go Decay (NGD) pathway.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "19420139",
                    "url": "https://glygen.org/publication/PubMed/19420139"
                }
            ]
        },
        {
            "start_pos": 174,
            "end_pos": 177,
            "sequence_org": "KKKR",
            "sequence_mut": "AAAA",
            "comment": "Reduced ability to trigger the No-Go Decay (NGD) pathway, reduced ability to promote degradation of non-functional rRNAs.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "21102444",
                    "url": "https://glygen.org/publication/PubMed/21102444"
                }
            ]
        },
        {
            "start_pos": 216,
            "end_pos": 216,
            "sequence_org": "P",
            "sequence_mut": "A",
            "comment": "Reduced No-Go Decay (NGD) pathway.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "19420139",
                    "url": "https://glygen.org/publication/PubMed/19420139"
                }
            ]
        },
        {
            "start_pos": 216,
            "end_pos": 218,
            "sequence_org": "PGF",
            "sequence_mut": "AAA",
            "comment": "Reduced No-Go Decay (NGD) pathway.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "19420139",
                    "url": "https://glygen.org/publication/PubMed/19420139"
                }
            ]
        },
        {
            "start_pos": 23,
            "end_pos": 23,
            "sequence_org": "E",
            "sequence_mut": "A",
            "comment": "Does not affect the No-Go Decay (NGD) pathway.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "19420139",
                    "url": "https://glygen.org/publication/PubMed/19420139"
                }
            ]
        },
        {
            "start_pos": 26,
            "end_pos": 26,
            "sequence_org": "E",
            "sequence_mut": "A",
            "comment": "Does not affect the No-Go Decay (NGD) pathway.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "19420139",
                    "url": "https://glygen.org/publication/PubMed/19420139"
                }
            ]
        },
        {
            "start_pos": 27,
            "end_pos": 27,
            "sequence_org": "D",
            "sequence_mut": "A",
            "comment": "Reduced No-Go Decay (NGD) pathway.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "19420139",
                    "url": "https://glygen.org/publication/PubMed/19420139"
                }
            ]
        },
        {
            "start_pos": 300,
            "end_pos": 300,
            "sequence_org": "Y",
            "sequence_mut": "A",
            "comment": "Reduced ability to trigger the No-Go Decay (NGD) pathway, reduced ability to promote degradation of non-functional rRNAs; when associated with A-361.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "21102444",
                    "url": "https://glygen.org/publication/PubMed/21102444"
                }
            ]
        },
        {
            "start_pos": 361,
            "end_pos": 361,
            "sequence_org": "E",
            "sequence_mut": "A",
            "comment": "Reduced ability to trigger the No-Go Decay (NGD) pathway, reduced ability to promote degradation of non-functional rRNAs; when associated with A-300.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "21102444",
                    "url": "https://glygen.org/publication/PubMed/21102444"
                }
            ]
        },
        {
            "start_pos": 361,
            "end_pos": 361,
            "sequence_org": "E",
            "sequence_mut": "R",
            "comment": "Reduced ability to trigger the No-Go Decay (NGD) pathway, reduced ability to promote degradation of non-functional rRNAs.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "21102444",
                    "url": "https://glygen.org/publication/PubMed/21102444"
                }
            ]
        },
        {
            "start_pos": 361,
            "end_pos": 364,
            "sequence_org": "ELDQ",
            "sequence_mut": "RLDA",
            "comment": "Reduced ability to trigger the No-Go Decay (NGD) pathway, reduced ability to promote degradation of non-functional rRNAs.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                },
                {
                    "database": "PubMed",
                    "id": "21102444",
                    "url": "https://glygen.org/publication/PubMed/21102444"
                }
            ]
        }
    ],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "DOM34",
            "url": "https://www.uniprot.org/uniprot/P33309",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "855731",
            "url": "https://www.ncbi.nlm.nih.gov/gene/855731",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P33309",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P33309*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR004405",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR004405",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR005140",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR005140",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR005141",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR005141",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR005142",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR005142",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR029064",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR029064",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR038069",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR038069",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR042226",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR042226",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YNL001W",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL001W",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "LKMIILC",
            "url": "https://omabrowser.org/oma/group/LKMIILC/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "758143at2759",
            "url": "http://www.orthodb.org/?query=758143at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10853",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10853",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10853:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10853:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2VGM",
            "url": "https://www.rcsb.org/structure/2VGM",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2VGN",
            "url": "https://www.rcsb.org/structure/2VGN",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3IZQ",
            "url": "https://www.rcsb.org/structure/3IZQ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3J16",
            "url": "https://www.rcsb.org/structure/3J16",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5M1J",
            "url": "https://www.rcsb.org/structure/5M1J",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF03463",
            "url": "http://pfam.xfam.org/family/PF03463",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF03464",
            "url": "http://pfam.xfam.org/family/PF03464",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF03465",
            "url": "http://pfam.xfam.org/family/PF03465",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P33309",
            "url": "http://purl.obolibrary.org/obo/PR_P33309",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_014397",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014397",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000004946",
            "url": "https://www.yeastgenome.org/locus/S000004946",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P33309",
            "url": "https://www.uniprot.org/uniprot/P33309",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P33309-1",
            "url": "https://www.uniprot.org/uniprot/P33309-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTSKLDEAGKKKSTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYSMPKKKRTTDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDEDDGEE",
        "length": 386,
        "header": "sp|P33309-1|DOM34_YEAST Isoform 1 of Protein DOM34  OS=Saccharomyces cerevisiae S288C OX=559292 GN=DOM34 PE=1 SV=2 CANONICAL=P33309-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P33309-1",
            "url": "",
            "sequence": {
                "sequence": "MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTSKLDEAGKKKSTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYSMPKKKRTTDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDEDDGEE",
                "length": 386,
                "header": "sp|P33309-1|DOM34_YEAST Isoform 1 of Protein DOM34  OS=Saccharomyces cerevisiae S288C OX=559292 GN=DOM34 PE=1 SV=2 CANONICAL=P33309-1"
            },
            "locus": {
                "chromosome": "XIV",
                "start_pos": 628613,
                "end_pos": 627456,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YNL001W_mRNA",
                        "url": "https://www.ensembl.org/id/YNL001W_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YNL001W",
                        "url": "https://www.ensembl.org/id/YNL001W"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Novel G-protein complex whose requirement is linked to the translational status of the cell.",
            "journal": "Mol. Cell. Biol.",
            "date": "2002",
            "authors": "Carr-Schmid Anne, Pfund Christine, Craig Elizabeth A, Kinzy Terri Goss",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11909951",
                    "url": "https://glygen.org/publication/PubMed/11909951"
                }
            ]
        },
        {
            "title": "Global analysis of protein localization in budding yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562095",
                    "url": "https://glygen.org/publication/PubMed/14562095"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "Endonucleolytic cleavage of eukaryotic mRNAs with stalls in translation elongation.",
            "journal": "Nature",
            "date": "2006",
            "authors": "Parker R., Doma M.K.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16554824",
                    "url": "https://glygen.org/publication/PubMed/16554824"
                }
            ]
        },
        {
            "title": "Structural and functional insights into Dom34, a key component of no-go mRNA decay.",
            "journal": "Mol. Cell",
            "date": "2007",
            "authors": "Kim H.S., Kim S.J., Kim K.H., Song H.K., Suh S.W., Lee S.J., Kim H.K., Kim O., Kim Y.-S., Yoon H.J., Kim do J., Park C.-M., Lee H.H., Kim S.K., Heo I., Kim V.N., Yoon J.Y., Lee B.G.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17889667",
                    "url": "https://glygen.org/publication/PubMed/17889667"
                }
            ]
        },
        {
            "title": "Structure of yeast Dom34: a protein related to translation termination factor Erf1 and involved in No-Go decay.",
            "journal": "J. Biol. Chem.",
            "date": "2008",
            "authors": "van Tilbeurgh H., Graille M., Chaillet M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18180287",
                    "url": "https://glygen.org/publication/PubMed/18180287"
                }
            ]
        },
        {
            "title": "Analysis of Dom34 and its function in no-go decay.",
            "journal": "Mol. Biol. Cell",
            "date": "2009",
            "authors": "Passos DO, Doma MK, Shoemaker CJ, Muhlrad D, Green R, Weissman J, Hollien J, Parker R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19420139",
                    "url": "https://glygen.org/publication/PubMed/19420139"
                }
            ]
        },
        {
            "title": "Dom34:Hbs1 promotes subunit dissociation and peptidyl-tRNA drop-off to initiate no-go decay.",
            "journal": "Science",
            "date": "2010",
            "authors": "Green R., Shoemaker C.J., Eyler D.E.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20947765",
                    "url": "https://glygen.org/publication/PubMed/20947765"
                }
            ]
        },
        {
            "title": "Dissection of Dom34-Hbs1 reveals independent functions in two RNA quality control pathways.",
            "journal": "Nat. Struct. Mol. Biol.",
            "date": "2010",
            "authors": "van den Elzen Antonia M G, Henri Julien, Lazar Noureddine, Gas Mar\u00eda Eugenia, Durand Dominique, Lacroute Fran\u00e7ois, Nicaise Magali, van Tilbeurgh Herman, S\u00e9raphin Bertrand, Graille Marc",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21102444",
                    "url": "https://glygen.org/publication/PubMed/21102444"
                }
            ]
        },
        {
            "title": "Structure of the no-go mRNA decay complex Dom34-Hbs1 bound to a stalled 80S ribosome.",
            "journal": "Nat. Struct. Mol. Biol.",
            "date": "2011",
            "authors": "Becker T., Villa E., Anger A.M., Armache J.P., Beckmann R., Berninghausen O., Mielke T., Sieber H., Jarasch A., Motaal B.A.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21623367",
                    "url": "https://glygen.org/publication/PubMed/21623367"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.",
            "journal": "Nat. Commun.",
            "date": "2016",
            "authors": "Yamamoto H., Buerger J., Mielke T., Spahn C.M., Loerke J., Hilal T.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27995908",
                    "url": "https://glygen.org/publication/PubMed/27995908"
                }
            ]
        },
        {
            "title": "Organization of the centromeric region of chromosome XIV in Saccharomyces cerevisiae.",
            "journal": "Yeast",
            "date": "1994",
            "authors": "Thuriaux P., Lalo D., Stettler S., Gendreau E., Mariotte S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7941739",
                    "url": "https://glygen.org/publication/PubMed/7941739"
                }
            ]
        },
        {
            "title": "Nucleotide sequence analysis of an 8887 bp region of the left arm of yeast chromosome XIV, encompassing the centromere sequence.",
            "journal": "Yeast",
            "date": "1994",
            "authors": "Verhasselt P., Volckaert G., Voet M., Aert R.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7985421",
                    "url": "https://glygen.org/publication/PubMed/7985421"
                }
            ]
        },
        {
            "title": "Two yeast chromosomes are related by a fossil duplication of their centromeric regions.",
            "journal": "C. R. Acad. Sci. III, Sci. Vie",
            "date": "1993",
            "authors": "Slonimski P.P., Thuriaux P., Lalo D., Stettler S., Mariotte S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8402262",
                    "url": "https://glygen.org/publication/PubMed/8402262"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P33309",
                    "url": "https://www.uniprot.org/uniprot/P33309"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169873",
                    "url": "https://glygen.org/publication/PubMed/9169873"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YNL001W",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL001W",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 10,
                "go_terms": [
                    {
                        "name": "rescue of stalled ribosome",
                        "id": "GO:0072344",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072344",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ribosome disassembly",
                        "id": "GO:0032790",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032790",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nuclear-transcribed mRNA catabolic process, non-stop decay",
                        "id": "GO:0070481",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070481",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nonfunctional rRNA decay",
                        "id": "GO:0070651",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070651",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "RNA surveillance",
                        "id": "GO:0071025",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071025",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell division",
                        "id": "GO:0051301",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of translation",
                        "id": "GO:0045727",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045727",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "meiotic cell cycle",
                        "id": "GO:0051321",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051321",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of translational initiation",
                        "id": "GO:0045948",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045948",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nuclear-transcribed mRNA catabolic process, no-go decay",
                        "id": "GO:0070966",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070966",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "Dom34-Hbs1 complex",
                        "id": "GO:1990533",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990533",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "metal ion binding",
                        "id": "GO:0046872",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "RNA endonuclease activity",
                        "id": "GO:0004521",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004521",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P33309",
                                "url": "https://www.uniprot.org/uniprot/P33309"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 16
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}