{ "uniprot_canonical_ac": "P32523-1", "uniprot_ac": "P32523", "uniprot_id": "PRP19_YEAST", "mass": { "chemical_mass": 56570.0, "monoisotopic_mass": 56570.0 }, "refseq": { "ac": "NP_013064", "name": "E3 ubiquitin-protein ligase PRP19", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013064" }, "gene_names": [ { "name": "PRP19", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P32523", "id": "P32523" }, { "name": "PRP19", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013064", "id": "NP_013064" }, { "name": "PSO4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013064", "id": "NP_013064" }, { "name": "PSO4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P32523", "id": "P32523" } ], "protein_names": [ { "name": "Pre-mRNA-processing factor 19", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P32523" }, { "name": "2.3.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32523" }, { "name": "E3 ubiquitin-protein ligase PRP19", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013064", "id": "NP_013064" }, { "name": "RING-type E3 ubiquitin transferase PRP19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32523" } ], "function": [ { "annotation": "Probable ubiquitin-protein ligase involved in pre-mRNA splicing. Acts as a central component of the NTC complex (or PRP19-associated complex) that associates to the spliceosome to mediate conformational rearrangement or to stabilize the structure of the spliceosome after U4 snRNA dissociation, which leads to spliceosome maturation. It is also probably involved in DNA repair.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523#function" }, { "database": "PubMed", "id": "12627222", "url": "https://glygen.org/publication/PubMed/12627222" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "common_name": "Yeast" } ], "gene": [ { "name": "PRP19", "url": "https://www.uniprot.org/uniprot/P32523", "locus": { "chromosome": "XII", "start_pos": 66745, "end_pos": 68256, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YLL036C", "url": "https://www.ensembl.org/id/YLL036C" } ] } } ], "crossref": [ { "id": "2.3.2.27", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.3.2.27&UniProtAcc=P32523", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd16656", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16656", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5058", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5058", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "850623", "url": "https://www.ncbi.nlm.nih.gov/gene/850623", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P32523", "url": "https://www.ebi.ac.uk/intact/interactors/id:P32523*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003613", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003613", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011047", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013915", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013915", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015943", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015943", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038959", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038959", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YLL036C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLL036C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TSLQNEW", "url": "https://omabrowser.org/oma/group/TSLQNEW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "130592at2759", "url": "http://www.orthodb.org/?query=130592at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43995", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43995", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43995:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43995:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1N87", "url": "https://www.rcsb.org/structure/1N87", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BAY", "url": "https://www.rcsb.org/structure/2BAY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LRV", "url": "https://www.rcsb.org/structure/3LRV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZB4", "url": "https://www.rcsb.org/structure/4ZB4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GM6", "url": "https://www.rcsb.org/structure/5GM6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GMK", "url": "https://www.rcsb.org/structure/5GMK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LJ5", "url": "https://www.rcsb.org/structure/5LJ5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M8C", "url": "https://www.rcsb.org/structure/5M8C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MQ0", "url": "https://www.rcsb.org/structure/5MQ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WSG", "url": "https://www.rcsb.org/structure/5WSG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y88", "url": "https://www.rcsb.org/structure/5Y88", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YLZ", "url": "https://www.rcsb.org/structure/5YLZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BK8", "url": "https://www.rcsb.org/structure/6BK8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EXN", "url": "https://www.rcsb.org/structure/6EXN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J6G", "url": "https://www.rcsb.org/structure/6J6G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J6H", "url": "https://www.rcsb.org/structure/6J6H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J6N", "url": "https://www.rcsb.org/structure/6J6N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J6Q", "url": "https://www.rcsb.org/structure/6J6Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08606", "url": "http://pfam.xfam.org/family/PF08606", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P32523", "url": "http://purl.obolibrary.org/obo/PR_P32523", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013064", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000003959", "url": "https://www.yeastgenome.org/locus/S000003959", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P32523-1", "url": "https://www.uniprot.org/uniprot/P32523-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQQASLTESTNSATLKANYSIPNLLTSLQNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAKLVAAQLLMEKNEDSKDLPKSSQQAVAITREEFLQGLLQSSRDFVARGKLKAPKWPILKNLELLQAQNYSRNIKTFPYKELNKSMYYDKWVCMCRCEDGALHFTQLKDSKTITTITTPNPRTGGEHPAIISRGPCNRLLLLYPGNQITILDSKTNKVLREIEVDSANEIIYMYGHNEVNTEYFIWADNRGTIGFQSYEDDSQYIVHSAKSDVEYSSGVLHKDSLLLALYSPDGILDVYNLSSPDQASSRFPVDEEAKIKEVKFADNGYWMVVECDQTVVCFDLRKDVGTLAYPTYTIPEFKTGTVTYDIDDSGKNMIAYSNESNSLTIYKFDKKTKNWTKDEESALCLQSDTADFTDMDVVCGDGGIAAILKTNDSFNIVALTP", "length": 503, "header": "sp|P32523-1|PRP19_YEAST Isoform 1 of Pre-mRNA-processing factor 19 OS=Saccharomyces cerevisiae S288C OX=559292 GN=PRP19 PE=1 SV=2 CANONICAL=P32523-1" }, "isoforms": [ { "isoform_ac": "P32523-1", "url": "", "sequence": { "sequence": "MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQQASLTESTNSATLKANYSIPNLLTSLQNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAKLVAAQLLMEKNEDSKDLPKSSQQAVAITREEFLQGLLQSSRDFVARGKLKAPKWPILKNLELLQAQNYSRNIKTFPYKELNKSMYYDKWVCMCRCEDGALHFTQLKDSKTITTITTPNPRTGGEHPAIISRGPCNRLLLLYPGNQITILDSKTNKVLREIEVDSANEIIYMYGHNEVNTEYFIWADNRGTIGFQSYEDDSQYIVHSAKSDVEYSSGVLHKDSLLLALYSPDGILDVYNLSSPDQASSRFPVDEEAKIKEVKFADNGYWMVVECDQTVVCFDLRKDVGTLAYPTYTIPEFKTGTVTYDIDDSGKNMIAYSNESNSLTIYKFDKKTKNWTKDEESALCLQSDTADFTDMDVVCGDGGIAAILKTNDSFNIVALTP", "length": 503, "header": "sp|P32523-1|PRP19_YEAST Isoform 1 of Pre-mRNA-processing factor 19 OS=Saccharomyces cerevisiae S288C OX=559292 GN=PRP19 PE=1 SV=2 CANONICAL=P32523-1" }, "locus": { "chromosome": "XII", "start_pos": 68256, "end_pos": 66748, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YLL036C_mRNA", "url": "https://www.ensembl.org/id/YLL036C_mRNA" }, { "database": "Ensembl Peptide", "id": "YLL036C", "url": "https://www.ensembl.org/id/YLL036C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 110, "end_pos": 110, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P32523", "url": "https://www.yeastgenome.org/locus/P32523" } ], "site_lbl": "Ser110" }, { "start_pos": 140, "end_pos": 140, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P32523", "url": "https://www.yeastgenome.org/locus/P32523" } ], "site_lbl": "Ser140" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser141" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser141" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P32523", "url": "https://www.yeastgenome.org/locus/P32523" }, { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser141" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Proteomics analysis reveals stable multiprotein complexes in both fission and budding yeasts containing Myb-related Cdc5p/Cef1p, novel pre-mRNA splicing factors, and snRNAs.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Ohi MD, Link AJ, Ren L, Jennings JL, McDonald WH, Gould KL", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "11884590", "url": "https://glygen.org/publication/PubMed/11884590" } ] }, { "title": "Structural insights into the U-box, a domain associated with multi-ubiquitination.", "journal": "Nat. Struct. Biol.", "date": "2003", "authors": "Gould K.L., Chazin W.J., Vander Kooi C.W., Ohi M.D., Rosenberg J.A.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "12627222", "url": "https://glygen.org/publication/PubMed/12627222" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Assigning function to yeast proteins by integration of technologies.", "journal": "Mol. Cell", "date": "2003", "authors": "Anderson S., Yates J.R. III, Baker D., Fields S., Bradley P., Fox B., Hazbun T.R., Davis T.N., Chiu C.-H., Malmstroem L., Aranda J.D., Graczyk B.J., McDonald W.H., Muller E.G.D., Riffle M., Snydsman B.E., Sundin B.A.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "14690591", "url": "https://glygen.org/publication/PubMed/14690591" } ] }, { "title": "Structural and functional analysis of essential pre-mRNA splicing factor Prp19p.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Gould K.L., Chazin W.J., Walz T., Vander Kooi C.W., Ren L., Hirsch J.P., Ohi M.D., Rosenberg J.A.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "15601865", "url": "https://glygen.org/publication/PubMed/15601865" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Mol. Cell. Proteomics", "date": "2008", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" }, { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science", "date": "2009", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" }, { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "A proteome-wide analysis of kinase-substrate network in the DNA damage response.", "journal": "The Journal of biological chemistry", "date": "2010-04-23", "authors": "Chen Sheng-hong, Albuquerque Claudio P, Liang Jason, Suhandynata Raymond T, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" } ], "reference": [ { "type": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "22814378", "url": "https://glygen.org/publication/PubMed/22814378" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The yeast PRP19 protein is not tightly associated with small nuclear RNAs, but appears to associate with the spliceosome after binding of U2 to the pre-mRNA and prior to formation of the functional spliceosome.", "journal": "Mol. Cell. Biol.", "date": "1993", "authors": "Tarn W.Y., Cheng S.C., Lee K.R.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "7680101", "url": "https://glygen.org/publication/PubMed/7680101" } ] }, { "title": "Functional association of essential splicing factor(s) with PRP19 in a protein complex.", "journal": "EMBO J.", "date": "1994", "authors": "Tarn W.Y., Kao H.Y., Cheng S.C., Hsu C.H., Chen H.R., Huang K.T., Lee K.R.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "8194532", "url": "https://glygen.org/publication/PubMed/8194532" } ] }, { "title": "PRP19: a novel spliceosomal component.", "journal": "Mol. Cell. Biol.", "date": "1993", "authors": "Tarn W.Y., Cheng S.C., Abelson J., Tsao T.Y.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "8441419", "url": "https://glygen.org/publication/PubMed/8441419" } ] }, { "title": "Allelism of PSO4 and PRP19 links pre-mRNA processing with recombination and error-prone DNA repair in Saccharomyces cerevisiae.", "journal": "Nucleic Acids Res.", "date": "1996", "authors": "Duesterhoeft A., Grey M., Brendel M., Henriques J.A.P.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "8918805", "url": "https://glygen.org/publication/PubMed/8918805" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] } ], "pathway": [ { "id": "sce:YLL036C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLL036C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "generation of catalytic spliceosome for first transesterification step", "id": "GO:0000349", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000349", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "mRNA splicing, via spliceosome", "id": "GO:0000398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000398", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "protein K63-linked ubiquitination", "id": "GO:0070534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070534", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "U2-type catalytic step 1 spliceosome", "id": "GO:0071006", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071006", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "Prp19 complex", "id": "GO:0000974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000974", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" }, { "name": "ubiquitin-protein transferase activity", "id": "GO:0004842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", "evidence": [ { "database": "UniProtKB", "id": "P32523", "url": "https://www.uniprot.org/uniprot/P32523" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 187, "end_pos": 189, "annotation": "n_glycosylation_sequon" }, { "start_pos": 201, "end_pos": 203, "annotation": "n_glycosylation_sequon" }, { "start_pos": 358, "end_pos": 360, "annotation": "n_glycosylation_sequon" }, { "start_pos": 440, "end_pos": 442, "annotation": "n_glycosylation_sequon" }, { "start_pos": 456, "end_pos": 458, "annotation": "n_glycosylation_sequon" }, { "start_pos": 493, "end_pos": 495, "annotation": "n_glycosylation_sequon" }, { "start_pos": 74, "end_pos": 76, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-SCE-6782131", "name": "ERCC2-facilitated RNA Pol II backtracking in TC-NER", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04050-1", "P06242-1", "P06839-1", "P08518-1", "P53691-1", "Q00578-1", "Q01476-1", "P50101-1", "P40352-1", "P32523-1" ], "evidence": [ { "id": "R-SCE-6782131", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-6782131" } ] }, { "id": "R-SCE-6782208", "name": "Repair DNA synthesis of ~27-30 bases long patch by POLD, POLE or POLK in TC-NER", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-ALL-30555" ], "output_participant_list": [], "enzyme_list": [ "P04050-1", "P06242-1", "P06839-1", "P08518-1", "P53691-1", "Q00578-1", "Q01476-1", "P50101-1", "P40352-1", "P32523-1" ], "evidence": [ { "id": "R-SCE-6782208", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-6782208" } ] }, { "id": "R-SCE-9684118", "name": "ERCC3-facilitated RNA Pol II backtracking in TC-NER", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04050-1", "P06242-1", "P06839-1", "P08518-1", "P53691-1", "Q00578-1", "Q01476-1", "P50101-1", "P40352-1", "P32523-1" ], "evidence": [ { "id": "R-SCE-9684118", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-9684118" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-30555", "participant_name": "dNTP [nucleoplasm]", "crossref": [ { "id": "16516", "database": "ChEBI", "url": "" }, { "id": "C04283", "database": "COMPOUND", "url": "" }, { "id": "16516", "database": "ChEBI", "url": "" }, { "id": "C04283", "database": "COMPOUND", "url": "" }, { "id": "16516", "database": "ChEBI", "url": "" }, { "id": "C04283", "database": "COMPOUND", "url": "" }, { "id": "C04283", "database": "COMPOUND", "url": "" }, { "id": "16516", "database": "ChEBI", "url": "" }, { "id": "16516", "database": "ChEBI", "url": "" }, { "id": "C04283", "database": "COMPOUND", "url": "" }, { "id": "16516", "database": "ChEBI", "url": "" }, { "id": "C04283", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P04050", "gene_name": "RPO21", "activity": [ { "ec_number": "2.7.7.6", "activity": "a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1).", "evidence": [ { "id": "P04050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04050" } ] }, { "ec_number": "2.7.7.6", "activity": "", "evidence": [ { "id": "P04050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04050" } ] } ] }, { "uniprot_ac": "P06242", "gene_name": "KIN28", "activity": [ { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P06242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06242" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P06242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06242" } ] } ] }, { "uniprot_ac": "P06839", "gene_name": "RAD3", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P06839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06839" } ] }, { "ec_number": "3.6.4.12", "activity": "", "evidence": [ { "id": "P06839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06839" } ] } ] }, { "uniprot_ac": "P08518", "gene_name": "RPB2", "activity": [ { "ec_number": "2.7.7.6", "activity": "a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1).", "evidence": [ { "id": "P08518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08518" } ] }, { "ec_number": "2.7.7.6", "activity": "", "evidence": [ { "id": "P08518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08518" } ] } ] }, { "uniprot_ac": "P32523", "gene_name": "PRP19", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P32523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32523" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P32523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32523" } ] } ] }, { "uniprot_ac": "P40352", "gene_name": "RAD26", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P40352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40352" } ] }, { "ec_number": "3.6.4.12", "activity": "", "evidence": [ { "id": "P40352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40352" } ] } ] }, { "uniprot_ac": "P50101", "gene_name": "UBP15", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "P50101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50101" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "P50101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50101" } ] } ] }, { "uniprot_ac": "P53691", "gene_name": "CPR6", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "P53691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53691" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "P53691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53691" } ] } ] }, { "uniprot_ac": "Q00578", "gene_name": "SSL2", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q00578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00578" } ] }, { "ec_number": "3.6.4.12", "activity": "", "evidence": [ { "id": "Q00578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00578" } ] } ] }, { "uniprot_ac": "Q01476", "gene_name": "UBP2", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q01476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01476" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q01476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01476" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }