{ "uniprot_canonical_ac": "P32392-1", "uniprot_ac": "P32392", "uniprot_id": "ARP3_DROME", "mass": { "chemical_mass": 47033.0, "monoisotopic_mass": 47033.0 }, "refseq": { "ac": "NP_001261559", "name": "Actin-related protein 3, isoform B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261559" }, "gene_names": [ { "name": "Arp3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P32392", "id": "P32392" }, { "name": "Actr66B; AcTr66B; anon-WO0172774.138; arp3; ARP3; arp66b; arp66B; Arp66B; CG7558; Dmel\\CG7558; schwachling", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261559", "id": "NP_001261559" }, { "name": "Actr66B", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P32392", "id": "P32392" }, { "name": "Arp3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261559", "id": "NP_001261559" }, { "name": "Arp66B", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P32392", "id": "P32392" }, { "name": "CG7558", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P32392", "id": "P32392" } ], "protein_names": [ { "name": "Actin-related protein 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P32392" }, { "name": "Actin-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32392" }, { "name": "Actin-like protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32392" }, { "name": "Actin-like protein 66B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32392" }, { "name": "Actin-related protein 3, isoform B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261559", "id": "NP_001261559" }, { "name": "CG7558-PB; Arp3-PB; Actin-related protein; schwachling; actin-related protein-3; Actin-related protein 66B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261559", "id": "NP_001261559" } ], "function": [ { "annotation": "Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks (By similarity). Seems to contact the pointed end of the daughter actin filament (By similarity). Required during embryogenesis for the developmental migration of tail hemocytes anteriorly, along the ventral midline (PubMed:25739458).", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392#function" }, { "database": "PubMed", "id": "25739458", "url": "https://glygen.org/publication/PubMed/25739458" }, { "database": "UniProtKB", "id": "P61158", "url": "https://www.uniprot.org/uniprot/P61158#function" } ] } ], "disease": [ { "disease_id": "DOID:0080199", "recommended_name": { "id": "DOID:0080199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080199", "name": "colorectal carcinoma", "description": "A colorectal cancer that arises from the colon or rectum and invades through the muscularis mucosa into the submucosa." }, "synonyms": [], "evidence": [ { "id": "0080199", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080199" } ] }, { "disease_id": "DOID:1312", "recommended_name": { "id": "DOID:1312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1312", "name": "focal segmental glomerulosclerosis", "description": "" }, "synonyms": [ { "id": "DOID:1312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1312", "name": "FGS", "description": "" }, { "id": "DOID:1312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1312", "name": "FSGS", "description": "" }, { "id": "DOID:1312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1312", "name": "focal glomerular sclerosis", "description": "" }, { "id": "DOID:1312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1312", "name": "focal glomerulosclerosis", "description": "" }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "focal segmental glomerulosclerosis 1", "description": "Any focal segmental glomerulosclerosis in which the cause of the disease is a mutation in the ACTN4 gene." }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "ACTN4 focal segmental glomerulosclerosis", "description": "" }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "FSGS1", "description": "" }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "familial idiopathic steroid-resistant nephrotic syndrome with focal segmental glomerulosclerosis", "description": "" }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "focal segmental glomerulosclerosis 1", "description": "" }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "focal segmental glomerulosclerosis caused by mutation in ACTN4", "description": "" }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "focal segmental glomerulosclerosis type 1", "description": "" }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis", "description": "" }, { "id": "MONDO:0011303", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011303", "name": "glomerulosclerosis, focal segmental, 1", "description": "" }, { "id": "MIM:603278", "resource": "MIM", "url": "https://www.omim.org/entry/603278", "name": "Focal segmental glomerulosclerosis 1", "description": "Focal segmental glomerulosclerosis 1" } ], "evidence": [ { "id": "1312", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1312" } ] }, { "disease_id": "DOID:13768", "recommended_name": { "id": "DOID:13768", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13768", "name": "opisthorchiasis", "description": "A parasitic helminthiasis infectious disease that involves parasitic infection of the liver, pancreas and gall bladder by Opisthorchis viverrini or Opisthorchis felineus. The symptoms include dyspepsia, abdominal pain, diarrhea, constipation, hepatomegaly, cholangitis, cholecystitis, and chlolangiocarcinoma." }, "synonyms": [ { "id": "DOID:13768", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13768", "name": "Infection by Opisthorchis", "description": "" } ], "evidence": [ { "id": "13768", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13768" } ] }, { "disease_id": "DOID:3068", "recommended_name": { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "glioblastoma", "description": "A malignant astrocytoma characterized by the presence of small areas of necrotizing tissue that is surrounded by anaplastic cells as well as the presence of hyperplastic blood vessels, and that has_material_basis_in abnormally proliferating cells derives_from multiple cell types including astrocytes and oligondroctyes." }, "synonyms": [ { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "GBM", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "adult glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "grade IV adult Astrocytic tumor", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "primary glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "spongioblastoma multiforme", "description": "" } ], "evidence": [ { "id": "3068", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3068" } ] }, { "disease_id": "DOID:4948", "recommended_name": { "id": "DOID:4948", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4948", "name": "gallbladder carcinoma", "description": "A gallbladder cancer that has_material_basis_in abnormally proliferating cells derives_from epithelial cells." }, "synonyms": [ { "id": "DOID:4948", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4948", "name": "cancer of the gallbladder", "description": "" }, { "id": "DOID:4948", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4948", "name": "carcinoma gallbladder", "description": "" }, { "id": "DOID:4948", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4948", "name": "carcinoma of gallbladder", "description": "" } ], "evidence": [ { "id": "4948", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4948" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Arp3", "url": "https://www.uniprot.org/uniprot/P32392", "locus": { "chromosome": "3L", "start_pos": 8113407, "end_pos": 8115902, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0262716", "url": "https://www.ensembl.org/id/FBgn0262716" } ] } } ], "crossref": [ { "id": "FBgn0262716", "url": "https://bgee.org/?page=gene&gene_id=FBgn0262716", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00012", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00012", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0262716", "url": "https://flybase.org/reports/FBgn0262716", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "38898", "url": "https://www.ncbi.nlm.nih.gov/gene/38898", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P32392", "url": "https://www.ebi.ac.uk/intact/interactors/id:P32392*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004000", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004000", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020902", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020902", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043129", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043129", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG7558", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG7558", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GIHYPIR", "url": "https://omabrowser.org/oma/group/GIHYPIR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "586415at2759", "url": "http://www.orthodb.org/?query=586415at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11937", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11937", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11937:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11937:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00022", "url": "http://pfam.xfam.org/family/PF00022", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P32392", "url": "http://purl.obolibrary.org/obo/PR_P32392", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2029482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-3928662", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-5663213", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5663213", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8856828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001261559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261559", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P32392-1", "url": "https://www.uniprot.org/uniprot/P32392-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYGPSICRHNPVFGTMT", "length": 418, "header": "sp|P32392-1|ARP3_DROME Isoform 1 of Actin-related protein 3 OS=Drosophila melanogaster OX=7227 GN=Arp3 PE=2 SV=3 CANONICAL=P32392-1" }, "isoforms": [ { "isoform_ac": "P32392-1", "url": "", "sequence": { "sequence": "MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYGPSICRHNPVFGTMT", "length": 418, "header": "sp|P32392-1|ARP3_DROME Isoform 1 of Actin-related protein 3 OS=Drosophila melanogaster OX=7227 GN=Arp3 PE=2 SV=3 CANONICAL=P32392-1" }, "locus": { "chromosome": "3L", "start_pos": 8115725, "end_pos": 8113959, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0076737", "url": "https://www.ensembl.org/id/FBtr0076737" }, { "database": "Ensembl Peptide", "id": "FBpp0076460", "url": "https://www.ensembl.org/id/FBpp0076460" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Wash functions downstream of Rho1 GTPase in a subset of Drosophila immune cell developmental migrations.", "journal": "Mol. Biol. Cell", "date": "2015", "authors": "Verboon JM, Rahe TK, Rodriguez-Mesa E, Parkhurst SM", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "reference": [ { "type": "PubMed", "id": "25739458", "url": "https://glygen.org/publication/PubMed/25739458" } ] }, { "title": "A Drosophila homologue of the Schizosaccharomyces pombe act2 gene.", "journal": "Biochem. Genet.", "date": "1993", "authors": "Fyrberg C., Fyrberg E.A.", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "reference": [ { "type": "PubMed", "id": "8274139", "url": "https://glygen.org/publication/PubMed/8274139" } ] } ], "pathway": [ { "id": "dme:Dmel_CG7558", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG7558", "resource": "KEGG Pathway" }, { "id": "R-DME-2029482", "name": "Regulation of actin dynamics for phagocytic cup formation", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2029482", "resource": "Reactome", "description": "Regulation of actin dynamics for phagocytic cup formation" }, { "id": "R-DME-3928662", "name": "EPHB-mediated forward signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-3928662", "resource": "Reactome", "description": "EPHB-mediated forward signaling" }, { "id": "R-DME-5663213", "name": "RHO GTPases Activate WASPs and WAVEs", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5663213", "resource": "Reactome", "description": "RHO GTPases Activate WASPs and WAVEs" }, { "id": "R-DME-8856828", "name": "Clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8856828", "resource": "Reactome", "description": "Clathrin-mediated endocytosis" } ], "orthologs": [ { "uniprot_canonical_ac": "P47117-1", "protein_name": "Actin-related protein 3", "gene_name": "ARP3", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIVRNFSLFNMV", "length": 449 }, "evidence": [ { "id": "P32392", "url": "https://omabrowser.org/oma/group/P32392/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P61158-1", "protein_name": "Actin-related protein 3", "gene_name": "ACTR3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS", "length": 418 }, "evidence": [ { "id": "P32392", "url": "https://omabrowser.org/oma/group/P32392/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q99JY9-1", "protein_name": "Actin-related protein 3", "gene_name": "Actr3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS", "length": 418 }, "evidence": [ { "id": "P32392", "url": "https://omabrowser.org/oma/group/P32392/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "terminal button organization", "id": "GO:0072553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072553", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "cell morphogenesis", "id": "GO:0000902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000902", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "actin cytoskeleton organization", "id": "GO:0030036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030036", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "myoblast fusion", "id": "GO:0007520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007520", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "Arp2/3 complex-mediated actin nucleation", "id": "GO:0034314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034314", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "axonal fasciculation", "id": "GO:0007413", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007413", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "positive regulation of synaptic assembly at neuromuscular junction", "id": "GO:0045887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045887", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "positive regulation of filopodium assembly", "id": "GO:0051491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051491", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "positive regulation of lamellipodium assembly", "id": "GO:0010592", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010592", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "plasma membrane tubulation", "id": "GO:0097320", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097320", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "chaeta development", "id": "GO:0022416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022416", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "pseudocleavage involved in syncytial blastoderm formation", "id": "GO:0030589", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030589", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "nuclear envelope budding", "id": "GO:0140591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140591", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "structural constituent of cytoskeleton", "id": "GO:0005200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005200", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "lamellipodium", "id": "GO:0030027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030027", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "Arp2/3 protein complex", "id": "GO:0005885", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005885", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" }, { "name": "nuclear lamina", "id": "GO:0005652", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005652", "evidence": [ { "database": "UniProtKB", "id": "P32392", "url": "https://www.uniprot.org/uniprot/P32392" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 199, "end_pos": 201, "annotation": "n_glycosylation_sequon" }, { "start_pos": 255, "end_pos": 257, "annotation": "n_glycosylation_sequon" }, { "start_pos": 352, "end_pos": 354, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }