{ "uniprot_canonical_ac": "P32304-1", "uniprot_ac": "P32304", "uniprot_id": "5HT7R_MOUSE", "mass": { "chemical_mass": 49916.0, "monoisotopic_mass": 49916.0 }, "refseq": { "ac": "NP_032341", "name": "5-hydroxytryptamine receptor 7 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341" }, "gene_names": [ { "name": "Htr7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P32304", "id": "P32304" }, { "name": "5-HT-X; 5-HT7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341", "id": "NP_032341" }, { "name": "Htr7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341", "id": "NP_032341" } ], "protein_names": [ { "name": "5-hydroxytryptamine receptor 7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P32304" }, { "name": "5-HT-7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32304" }, { "name": "5-HT-X", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32304" }, { "name": "5-HT7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32304" }, { "name": "5-hydroxytryptamine receptor 7 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341", "id": "NP_032341" }, { "name": "5-hydroxytryptamine receptor 7 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334371", "id": "NP_001334371" }, { "name": "5-hydroxytryptamine receptor 7; serotonin receptor 7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334371", "id": "NP_001334371" }, { "name": "Serotonin receptor 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P32304" } ], "function": [ { "annotation": "Cloning, genomic organization and functionality of 5-HT7 receptor splice variants from mouse brain are reported.", "evidence": [ { "database": "RefSeq", "id": "NP_032341", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341" }, { "database": "PubMed", "id": "18793707", "url": "https://glygen.org/publication/PubMed/18793707" }, { "database": "RefSeq", "id": "NP_001334371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334371" } ] }, { "annotation": "Effects of 5-HT7 receptors on circadian rhythm of mice anesthetized with isoflurane.", "evidence": [ { "database": "RefSeq", "id": "NP_032341", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341" }, { "database": "PubMed", "id": "33081564", "url": "https://glygen.org/publication/PubMed/33081564" }, { "database": "RefSeq", "id": "NP_001334371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334371" } ] }, { "annotation": "Serotonin 5-HT7 receptor overexpression in the raphe nuclei area produces antidepressive effect and affects brain serotonin system in male mice.", "evidence": [ { "database": "RefSeq", "id": "NP_032341", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341" }, { "database": "PubMed", "id": "35443076", "url": "https://glygen.org/publication/PubMed/35443076" }, { "database": "RefSeq", "id": "NP_001334371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334371" } ] }, { "annotation": "This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304#function" } ] } ], "disease": [ { "disease_id": "DOID:10914", "recommended_name": { "id": "DOID:10914", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10914", "name": "amnestic disorder", "description": "A cognitive disorder where the memory is disturbed or lost and involves the loss of memories previously established, loss of the ability to create new memories, or loss of the ability to learn new information." }, "synonyms": [ { "id": "DOID:10914", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10914", "name": "Amnestic syndrome", "description": "" }, { "id": "DOID:10914", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10914", "name": "Korsakoff's psychosis or syndrome", "description": "" }, { "id": "DOID:10914", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10914", "name": "amnesia", "description": "" } ], "evidence": [ { "id": "10914", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10914" } ] }, { "disease_id": "DOID:1561", "recommended_name": { "id": "DOID:1561", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1561", "name": "cognitive disorder", "description": "A disease of mental health that affects cognitive functions including memory processing, perception and problem solving." }, "synonyms": [ { "id": "DOID:1561", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1561", "name": "cognitive disease", "description": "" } ], "evidence": [ { "id": "1561", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1561" } ] }, { "disease_id": "DOID:1574", "recommended_name": { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol use disorder", "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences." }, "synonyms": [ { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "Ethanol abuse", "description": "" }, { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol abuse", "description": "" } ], "evidence": [ { "id": "1574", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1574" } ] }, { "disease_id": "DOID:1825", "recommended_name": { "id": "DOID:1825", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1825", "name": "childhood absence epilepsy", "description": "A childhood electroclinical syndrome that is characterized by brief and frequent absence seizures in children with age of onset between four and ten years." }, "synonyms": [ { "id": "DOID:1825", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1825", "name": "petit mal seizure", "description": "" }, { "id": "DOID:1825", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1825", "name": "pyknolepsy", "description": "" } ], "evidence": [ { "id": "1825", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1825" } ] }, { "disease_id": "DOID:2030", "recommended_name": { "id": "DOID:2030", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2030", "name": "anxiety disorder", "description": "A cognitive disorder that involves an excessive, irrational dread of everyday situations." }, "synonyms": [ { "id": "DOID:2030", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2030", "name": "anxiety", "description": "" }, { "id": "DOID:2030", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2030", "name": "anxiety state", "description": "" }, { "id": "MONDO:0011918", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011918", "name": "anxiety", "description": "" }, { "id": "MONDO:0011918", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011918", "name": "anxiety", "description": "" }, { "id": "MONDO:0011918", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011918", "name": "anxiety-related personality traits", "description": "" }, { "id": "MONDO:0011918", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011918", "name": "harm avoidance", "description": "" } ], "evidence": [ { "id": "2030", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2030" } ] }, { "disease_id": "DOID:6364", "recommended_name": { "id": "DOID:6364", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6364", "name": "migraine", "description": "A brain disease that is characterized by moderate to severe headaches, nausea, extreme sensitivity to light and sound and intense unilaterial throbbing or pulsing." }, "synonyms": [ { "id": "DOID:6364", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6364", "name": "migraine disorder", "description": "" }, { "id": "DOID:6364", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6364", "name": "migraine variant", "description": "" }, { "id": "DOID:6364", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6364", "name": "migraine with or without aura", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "migraine with or without aura, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "migraine with or without aura, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "migraine with or without aura, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "migraine without aura, susceptibility to", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "migraine, resistance to", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "migraine, susceptibility to", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "Mgau", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "Mgr1", "description": "" }, { "id": "MONDO:0008000", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008000", "name": "migraine", "description": "" } ], "evidence": [ { "id": "6364", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:6364" } ] }, { "disease_id": "DOID:9778", "recommended_name": { "id": "DOID:9778", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9778", "name": "irritable bowel syndrome", "description": "An intestinal disease that is characterized by chronic abdominal pain, discomfort, bloating, and alteration of bowel habits in the absence of any detectable organic cause." }, "synonyms": [ { "id": "DOID:9778", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9778", "name": "IBD", "description": "" }, { "id": "DOID:9778", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9778", "name": "Irritable colon", "description": "" } ], "evidence": [ { "id": "9778", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9778" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Htr7", "url": "https://www.uniprot.org/uniprot/P32304", "locus": { "chromosome": "19", "start_pos": 35936134, "end_pos": 36034907, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000024798", "url": "https://www.ensembl.org/id/ENSMUSG00000024798" } ] } } ], "crossref": [ { "id": "ENSMUSG00000024798", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000024798", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15329", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15329", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4764", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4764", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "15566", "url": "https://www.ncbi.nlm.nih.gov/gene/15566", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001069", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001069", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:15566", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15566", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "99841", "url": "http://www.informatics.jax.org/marker/MGI:99841", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "GFPRPEK", "url": "https://omabrowser.org/oma/group/GFPRPEK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2999405at2759", "url": "http://www.orthodb.org/?query=2999405at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24247", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24247", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24247:SF116", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24247:SF116", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24248", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24248", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24248:SF66", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24248:SF66", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P32304", "url": "http://purl.obolibrary.org/obo/PR_P32304", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-390666", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-390666", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9706019", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9706019", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_032341", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B6VJS2", "url": "https://www.uniprot.org/uniprot/B6VJS2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B6VJS2-1", "url": "https://www.uniprot.org/uniprot/B6VJS2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B6VJS3", "url": "https://www.uniprot.org/uniprot/B6VJS3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B6VJS3-1", "url": "https://www.uniprot.org/uniprot/B6VJS3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q1X2", "url": "https://www.uniprot.org/uniprot/E9Q1X2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q1X2-1", "url": "https://www.uniprot.org/uniprot/E9Q1X2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q4Q7", "url": "https://www.uniprot.org/uniprot/E9Q4Q7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q4Q7-1", "url": "https://www.uniprot.org/uniprot/E9Q4Q7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P32304-1", "url": "https://www.uniprot.org/uniprot/P32304-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERSEFVLQNCDHCGKKGHDT", "length": 448, "header": "sp|P32304-1|5HT7R_MOUSE Isoform 1 of 5-hydroxytryptamine receptor 7 OS=Mus musculus OX=10090 GN=Htr7 PE=2 SV=2 CANONICAL=P32304-1" }, "isoforms": [ { "isoform_ac": "B6VJS2-1", "url": "", "sequence": { "sequence": "MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERSEFVL", "length": 435, "header": "tr|B6VJS2-1|B6VJS2_MOUSE Computationally mapped isoform of 5-hydroxytryptamine receptor 7 OS=Mus musculus OX=10090 GN=Htr7 PE=2 SV=1 CANONICAL=P32304-1" }, "locus": { "chromosome": "19", "start_pos": 36034653, "end_pos": 35946708, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000166074.2", "url": "https://www.ensembl.org/id/ENSMUST00000166074.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000126150.2", "url": "https://www.ensembl.org/id/ENSMUSP00000126150.2" } ] } }, { "isoform_ac": "B6VJS3-1", "url": "", "sequence": { "sequence": "MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERSEFVLMTGASGVQKALENLPWGNGVNTGIKAVNSVALTKL", "length": 470, "header": "tr|B6VJS3-1|B6VJS3_MOUSE Computationally mapped isoform of 5-hydroxytryptamine receptor 7 OS=Mus musculus OX=10090 GN=Htr7 PE=2 SV=1 CANONICAL=P32304-1" }, "locus": { "chromosome": "19", "start_pos": 36034653, "end_pos": 35937791, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000099505.4", "url": "https://www.ensembl.org/id/ENSMUST00000099505.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000097105.4", "url": "https://www.ensembl.org/id/ENSMUSP00000097105.4" } ] } }, { "isoform_ac": "E9Q1X2-1", "url": "", "sequence": { "sequence": "MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVARRWKSVRTFRDCSNTKGKTFPSSRGNRKQPLPWGSSWEPSRCAGCRFSSCPQQGPLSVAPPVAASRCGWRGHVCGWAMQTLSLTLLYMPSSTGT", "length": 344, "header": "tr|E9Q1X2-1|E9Q1X2_MOUSE Computationally mapped isoform of 5-hydroxytryptamine receptor 7 OS=Mus musculus OX=10090 GN=Htr7 PE=3 SV=1 CANONICAL=P32304-1" }, "locus": { "chromosome": "19", "start_pos": 36034653, "end_pos": 35946833, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000170360.2", "url": "https://www.ensembl.org/id/ENSMUST00000170360.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000131517.2", "url": "https://www.ensembl.org/id/ENSMUSP00000131517.2" } ] } }, { "isoform_ac": "E9Q4Q7-1", "url": "", "sequence": { "sequence": "MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRESIAGHRRIGSLRKY", "length": 198, "header": "tr|E9Q4Q7-1|E9Q4Q7_MOUSE Computationally mapped isoform of 5-hydroxytryptamine receptor 7 OS=Mus musculus OX=10090 GN=Htr7 PE=4 SV=1 CANONICAL=P32304-1" }, "locus": { "chromosome": "19", "start_pos": 36034653, "end_pos": 36018967, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000164781.2", "url": "https://www.ensembl.org/id/ENSMUST00000164781.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000131912.2", "url": "https://www.ensembl.org/id/ENSMUSP00000131912.2" } ] } }, { "isoform_ac": "P32304-1", "url": "", "sequence": { "sequence": "MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERSEFVLQNCDHCGKKGHDT", "length": 448, "header": "sp|P32304-1|5HT7R_MOUSE Isoform 1 of 5-hydroxytryptamine receptor 7 OS=Mus musculus OX=10090 GN=Htr7 PE=2 SV=2 CANONICAL=P32304-1" }, "locus": { "chromosome": "19", "start_pos": 36034653, "end_pos": 35937760, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000164639", "url": "https://www.ensembl.org/id/ENSMUST00000164639" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000126847", "url": "https://www.ensembl.org/id/ENSMUSP00000126847" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 5, "start_aa": "Asn", "end_pos": 5, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn5", "evidence": [ { "id": "P32304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32304#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P32304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32304#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Cloning, genomic organization and functionality of 5-HT(7) receptor splice variants from mouse brain.", "journal": "Gene", "date": "2008", "authors": "Gellynck E, Laenen K, Andressen KW, Lintermans B, De Martelaere K, Matthys A, Levy FO, Haegeman G, Vanhoenacker P, Van Craenenbroeck K", "evidence": [ { "database": "RefSeq", "id": "NP_001334371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334371" }, { "database": "RefSeq", "id": "NP_032341", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341" } ], "reference": [ { "type": "PubMed", "id": "18793707", "url": "https://glygen.org/publication/PubMed/18793707" } ] }, { "title": "Effects of 5-HT7 receptors on circadian rhythm of mice anesthetized with isoflurane.", "journal": "Chronobiology international", "date": "2021", "authors": "Liu B, Chu S, Liu T, Song J, Ma Z, Gu X, Xia T", "evidence": [ { "database": "RefSeq", "id": "NP_001334371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334371" }, { "database": "RefSeq", "id": "NP_032341", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341" } ], "reference": [ { "type": "PubMed", "id": "33081564", "url": "https://glygen.org/publication/PubMed/33081564" } ] }, { "title": "Serotonin 5-HT(7) receptor overexpression in the raphe nuclei area produces antidepressive effect and affects brain serotonin system in male mice.", "journal": "Journal of neuroscience research", "date": "2022", "authors": "Rodnyy AY, Kondaurova EM, Bazovkina DV, Kulikova EA, Ilchibaeva TV, Kovetskaya AI, Baraboshkina IA, Bazhenova EY, Popova NK, Naumenko VS", "evidence": [ { "database": "RefSeq", "id": "NP_032341", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032341" }, { "database": "RefSeq", "id": "NP_001334371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334371" } ], "reference": [ { "type": "PubMed", "id": "35443076", "url": "https://glygen.org/publication/PubMed/35443076" } ] }, { "title": "Molecular cloning of a mammalian serotonin receptor that activates adenylate cyclase.", "journal": "Mol. Pharmacol.", "date": "1993", "authors": "Plassat JL, Amlaiky N, Hen R", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "reference": [ { "type": "PubMed", "id": "8394987", "url": "https://glygen.org/publication/PubMed/8394987" } ] } ], "pathway": [ { "id": "mmu:15566", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15566", "resource": "KEGG Pathway" }, { "id": "R-MMU-390666", "name": "Serotonin receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-390666", "resource": "Reactome", "description": "Serotonin receptors" }, { "id": "R-MMU-418555", "name": "G alpha (s) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418555", "resource": "Reactome", "description": "G alpha (s) signalling events" }, { "id": "R-MMU-9706019", "name": "RHOBTB3 ATPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9706019", "resource": "Reactome", "description": "RHOBTB3 ATPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "P32305-1", "protein_name": "5-hydroxytryptamine receptor 7", "gene_name": "Htr7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERSEFVLQNSDHCGKKGHDT", "length": 448 }, "evidence": [ { "id": "45235975", "url": "http://www.informatics.jax.org/homology/45235975", "database": "MGI" }, { "id": "P32304", "url": "https://omabrowser.org/oma/group/P32304/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P34969-1", "protein_name": "5-hydroxytryptamine receptor 7", "gene_name": "HTR7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD", "length": 479 }, "evidence": [ { "id": "45235975", "url": "http://www.informatics.jax.org/homology/45235975", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "axon terminus", "id": "GO:0043679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043679", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "postsynaptic membrane", "id": "GO:0045211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045211", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "synaptic vesicle", "id": "GO:0008021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008021", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "presynaptic membrane", "id": "GO:0042734", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042734", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 18, "go_terms": [ { "name": "smooth muscle contraction", "id": "GO:0006939", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006939", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "chemical synaptic transmission", "id": "GO:0007268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007268", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "vasoconstriction", "id": "GO:0042310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042310", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "memory", "id": "GO:0007613", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007613", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger", "id": "GO:0007187", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007187", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "serotonin receptor signaling pathway", "id": "GO:0007210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007210", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "negative regulation of serotonin secretion", "id": "GO:0014063", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014063", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "urinary bladder smooth muscle contraction", "id": "GO:0014832", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014832", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "detection of mechanical stimulus involved in sensory perception of pain", "id": "GO:0050966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050966", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "response to corticosterone", "id": "GO:0051412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051412", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "long-term synaptic potentiation", "id": "GO:0060291", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060291", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "behavioral response to pain", "id": "GO:0048266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048266", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "dopaminergic neuron differentiation", "id": "GO:0071542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071542", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "presynaptic modulation of chemical synaptic transmission", "id": "GO:0099171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099171", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "adenylate cyclase-activating serotonin receptor signaling pathway", "id": "GO:0007192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007192", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "regulation of vein smooth muscle contraction", "id": "GO:0062086", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062086", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled serotonin receptor activity", "id": "GO:0004993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004993", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" }, { "name": "neurotransmitter receptor activity", "id": "GO:0030594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030594", "evidence": [ { "database": "UniProtKB", "id": "P32304", "url": "https://www.uniprot.org/uniprot/P32304" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 307, "end_pos": 309, "annotation": "n_glycosylation_sequon" }, { "start_pos": 318, "end_pos": 320, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 69, "end_pos": 71, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }