{ "uniprot_canonical_ac": "P31240-1", "uniprot_ac": "P31240", "uniprot_id": "PDGFB_MOUSE", "mass": { "chemical_mass": 27382.0, "monoisotopic_mass": 27382.0 }, "refseq": { "ac": "NP_035187", "name": "platelet-derived growth factor subunit B isoform 1 preproprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" }, "gene_names": [ { "name": "Pdgfb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P31240", "id": "P31240" }, { "name": "Pdgfb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187", "id": "NP_035187" }, { "name": "Sis", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P31240", "id": "P31240" }, { "name": "c-sis; PDGF-2; PDGF-B; Sis", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187", "id": "NP_035187" } ], "protein_names": [ { "name": "Platelet-derived growth factor subunit B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P31240" }, { "name": "PDGF subunit B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P31240" }, { "name": "PDGF-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P31240" }, { "name": "Platelet-derived growth factor B chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P31240" }, { "name": "Platelet-derived growth factor beta polypeptide", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P31240" }, { "name": "Proto-oncogene c-Sis", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P31240" }, { "name": "platelet-derived growth factor subunit B isoform 1 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187", "id": "NP_035187" }, { "name": "platelet-derived growth factor subunit B; PDGF subunit B; platelet-derived growth factor B chain; platelet-derived growth factor beta polypeptide; proto-oncogene c-Sis", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187", "id": "NP_035187" } ], "function": [ { "annotation": "Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240#function" }, { "database": "PubMed", "id": "10734101", "url": "https://glygen.org/publication/PubMed/10734101" }, { "database": "PubMed", "id": "7958863", "url": "https://glygen.org/publication/PubMed/7958863" }, { "database": "PubMed", "id": "19030102", "url": "https://glygen.org/publication/PubMed/19030102" }, { "database": "PubMed", "id": "14561699", "url": "https://glygen.org/publication/PubMed/14561699" } ] }, { "annotation": "Lin28b delays vasculature aging by reducing platelet-derived growth factor-beta resistance in senescent vascular smooth muscle cells.", "evidence": [ { "database": "RefSeq", "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" }, { "database": "PubMed", "id": "36529087", "url": "https://glygen.org/publication/PubMed/36529087" } ] }, { "annotation": "PDGF-B secreted from skeletal muscle enhances myoblast proliferation and myotube maturation via activation of the PDGFR signaling cascade.", "evidence": [ { "database": "RefSeq", "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" }, { "database": "PubMed", "id": "36521377", "url": "https://glygen.org/publication/PubMed/36521377" } ] }, { "annotation": "Perivascular localized cells commit erythropoiesis in PDGF-B-expressing solid tumors.", "evidence": [ { "database": "RefSeq", "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" }, { "database": "PubMed", "id": "37120719", "url": "https://glygen.org/publication/PubMed/37120719" } ] }, { "annotation": "The Role of Platelet-Derived Growth Factor in Focal Segmental Glomerulosclerosis.", "evidence": [ { "database": "RefSeq", "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" }, { "database": "PubMed", "id": "36351762", "url": "https://glygen.org/publication/PubMed/36351762" } ] } ], "disease": [ { "disease_id": "DOID:0050127", "recommended_name": { "id": "DOID:0050127", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050127", "name": "sinusitis", "description": "A paranasal sinus disease involving inflammation of the paranasal sinuses resulting from bacterial, fungal, viral infection, allergic or autoimmune issues. Symptoms can include fever, weakness, fatigue, cough and congestion. There may also be mucus drainage in the back of the throat, called postnasal drip." }, "synonyms": [], "evidence": [ { "id": "0050127", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050127" } ] }, { "disease_id": "DOID:0050589", "recommended_name": { "id": "DOID:0050589", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050589", "name": "inflammatory bowel disease", "description": "An intestinal disease characterized by inflammation located in all parts of digestive tract." }, "synonyms": [ { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "inflammatory bowel disease 1", "description": "Any inflammatory bowel disease in which the cause of the disease is a mutation in the NOD2 gene." }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "IBD1", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "NOD2 inflammatory bowel disease", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "crohn disease-associated growth failure", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "inflammatory bowel disease 1", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "inflammatory bowel disease 1, Crohn disease", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "inflammatory bowel disease caused by mutation in NOD2", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "inflammatory bowel disease type 1", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "Crohn disease", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "Crohn disease-associated Growth failure, susceptibility to", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "inflammatory bowel disease (Crohn disease) 1", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "paediatric ulcerative colitis", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "pediatric ulcerative colitis", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "regional enteritis", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "ulcerative colitis", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "ulcerative colitis, paediatric", "description": "" }, { "id": "MONDO:0009960", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009960", "name": "ulcerative colitis, pediatric", "description": "" }, { "id": "MIM:266600", "resource": "MIM", "url": "https://www.omim.org/entry/266600", "name": "Inflammatory bowel disease 1", "description": "Inflammatory bowel disease 1" } ], "evidence": [ { "id": "0050589", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050589" } ] }, { "disease_id": "DOID:0060230", "recommended_name": { "id": "DOID:0060230", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060230", "name": "basal ganglia calcification", "description": "A basal ganglia disease characterized by the presence of abnormal calcium deposits of unknown cause in the brain; has symptom dementia, psychosis, mood swings and loss of acquired motor skills." }, "synonyms": [ { "id": "DOID:0060230", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060230", "name": "Fahr disease", "description": "" }, { "id": "MONDO:0014004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014004", "name": "basal ganglia calcification, idiopathic, 4", "description": "" }, { "id": "MONDO:0014004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014004", "name": "basal ganglia calcification, idiopathic, 4", "description": "" }, { "id": "MONDO:0014004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014004", "name": "basal ganglia calcification, idiopathic, type 4", "description": "" }, { "id": "MONDO:0014004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014004", "name": "IBGC4", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "basal ganglia calcification, idiopathic, 1", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "IBGC1", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "IBGC2", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "basal ganglia calcification, idiopathic, 1", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "basal ganglia calcification, idiopathic, 2", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "basal ganglia calcification, idiopathic, type 1", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "idiopathic basal ganglia calcification 1", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "Fahr disease, familial", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "Fahr disease, familial, formerly", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "basal ganglia calcification, idiopathic, 3", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "basal ganglia calcification, idiopathic, 3, formerly", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "cerebral calcification, nonarteriosclerotic, idiopathic, adult-onset", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "ferrocalcinosis, cerebrovascular", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "striopallidodentate calcinosis, autosomal dominant, adult-onset", "description": "" }, { "id": "MONDO:0024538", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024538", "name": "striopallidodentate calcinosis, bilateral", "description": "" }, { "id": "MONDO:0014204", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014204", "name": "basal ganglia calcification, idiopathic, 5", "description": "" }, { "id": "MONDO:0014204", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014204", "name": "basal ganglia calcification, idiopathic, 5", "description": "" }, { "id": "MONDO:0014204", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014204", "name": "basal ganglia calcification, idiopathic, type 5", "description": "" }, { "id": "MONDO:0014204", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014204", "name": "IBGC5", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "basal ganglia calcification, idiopathic, childhood-onset", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "basal ganglia calcification, idiopathic, childhood-onset", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "IBGC childhood onset", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "IBGC, childhood-onset", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "bilateral striopallidodentate calcinosis childhood-onset", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "cerebral calcification nonarteriosclerotic idiopathic childhood-onset", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "cerebral calcification, nonarteriosclerotic, idiopathic, childhood-onset", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "idiopathic basal ganglia calcification childhood-onset", "description": "" }, { "id": "MONDO:0007247", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007247", "name": "striopallidodentate calcinosis, bilateral, childhood-onset", "description": "" }, { "id": "MIM:615007", "resource": "MIM", "url": "https://www.omim.org/entry/615007", "name": "Basal ganglia calcification, idiopathic, 4", "description": "Basal ganglia calcification, idiopathic, 4" }, { "id": "MIM:213600", "resource": "MIM", "url": "https://www.omim.org/entry/213600", "name": "Basal ganglia calcification, idiopathic, 1", "description": "Basal ganglia calcification, idiopathic, 1" }, { "id": "MIM:615483", "resource": "MIM", "url": "https://www.omim.org/entry/615483", "name": "Basal ganglia calcification, idiopathic, 5", "description": "Basal ganglia calcification, idiopathic, 5" } ], "evidence": [ { "id": "0060230", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060230" } ] }, { "disease_id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2." }, "synonyms": [ { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019 Novel Coronavirus (2019-nCoV)", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019-nCoV infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan coronavirus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan seafood market pneumonia virus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID19", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "SARS-CoV-2 infection", "description": "" } ], "evidence": [ { "id": "0080600", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080600" } ] }, { "disease_id": "DOID:0081267", "recommended_name": { "id": "DOID:0081267", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081267", "name": "graft-versus-host disease", "description": "An immune system disease that is characterized by recognition by mature donor T cells, that contaminate the allogeneic bone marrow, of the recipient's tissue as foreign, causing a severe inflammatory disease characterized by rashes, diarrhea, and liver disease, and that has_material_basis_in an associated with variation in the interleukin-10 gene (IL10) on chromosome 1q32." }, "synonyms": [ { "id": "DOID:0081267", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081267", "name": "GvHD", "description": "" }, { "id": "DOID:0081267", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081267", "name": "graft versus host disease", "description": "" }, { "id": "MONDO:0100048", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100048", "name": "graft-versus-host disease, susceptibility to", "description": "An inherited susceptibility or predisposition to developing graft vs. host disease." }, { "id": "MONDO:0100048", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100048", "name": "GVHDS", "description": "" } ], "evidence": [ { "id": "0081267", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0081267" } ] }, { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:10873", "recommended_name": { "id": "DOID:10873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10873", "name": "Kuhnt-Junius degeneration", "description": "" }, "synonyms": [ { "id": "DOID:10873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10873", "name": "Exudative senile macular degeneration of retina", "description": "" }, { "id": "DOID:10873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10873", "name": "Neovascular age-related macular degeneration", "description": "" }, { "id": "DOID:10873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10873", "name": "Senile macular degeneration, wet", "description": "" }, { "id": "DOID:10873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10873", "name": "Wet senile macular retinal degeneration", "description": "" } ], "evidence": [ { "id": "10873", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10873" } ] }, { "disease_id": "DOID:11132", "recommended_name": { "id": "DOID:11132", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11132", "name": "prostatic hypertrophy", "description": "" }, "synonyms": [ { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hyperplasia", "description": "A non-cancerous nodular enlargement of the prostate gland. It is characterized by the presence of epithelial cell nodules, and stromal nodules containing fibrous and smooth muscle elements. It is the most common urologic disorder in men, causing blockage of urine flow." }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "prostate hypertrophy", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "prostatic hypertrophy", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign hyperplasia of prostate", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign hyperplasia of the prostate", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostate hyperplasia", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic Hypertrophy", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hyperplasia", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hyperplasia (disease)", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hyperplasia - BPH", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hypertrophy", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "BPH", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "prostatic hyperplasia, benign", "description": "" } ], "evidence": [ { "id": "11132", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11132" } ] }, { "disease_id": "DOID:11832", "recommended_name": { "id": "DOID:11832", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11832", "name": "visual epilepsy", "description": "" }, "synonyms": [ { "id": "DOID:11832", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11832", "name": "epilepsy, visual", "description": "" } ], "evidence": [ { "id": "11832", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11832" } ] }, { "disease_id": "DOID:12215", "recommended_name": { "id": "DOID:12215", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12215", "name": "oligohydramnios", "description": "A placenta disease that is characterized by a deficiency of amniotic fluid sometimes resulting in an embryonic defect through adherence between embryo and amnion." }, "synonyms": [ { "id": "DOID:12215", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12215", "name": "Oligohydramnios - delivered", "description": "" }, { "id": "DOID:12215", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12215", "name": "antepartum oligohydramnios", "description": "" }, { "id": "DOID:12215", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12215", "name": "delivered oligohydramnios", "description": "" } ], "evidence": [ { "id": "12215", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12215" } ] }, { "disease_id": "DOID:127", "recommended_name": { "id": "DOID:127", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:127", "name": "leiomyoma", "description": "A cell type benign neoplasm that is a benign tumor of smooth muscle cells." }, "synonyms": [ { "id": "DOID:127", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:127", "name": "leiomyomatous neoplasm", "description": "" }, { "id": "DOID:127", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:127", "name": "leiomyomatous tumor", "description": "" } ], "evidence": [ { "id": "127", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:127" } ] }, { "disease_id": "DOID:13207", "recommended_name": { "id": "DOID:13207", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13207", "name": "proliferative diabetic retinopathy", "description": "" }, "synonyms": [ { "id": "DOID:13207", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13207", "name": "PDR", "description": "" } ], "evidence": [ { "id": "13207", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13207" } ] }, { "disease_id": "DOID:13208", "recommended_name": { "id": "DOID:13208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13208", "name": "background diabetic retinopathy", "description": "" }, "synonyms": [ { "id": "DOID:13208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13208", "name": "Non proliferative diabetic retinopathy", "description": "" }, { "id": "DOID:13208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13208", "name": "Non-Proliferative Diabetic Retinopathy", "description": "" } ], "evidence": [ { "id": "13208", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13208" } ] }, { "disease_id": "DOID:13580", "recommended_name": { "id": "DOID:13580", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13580", "name": "cholestasis", "description": "A bile duct disease that is characterized by where bile cannot flow from the liver to the duodenum." }, "synonyms": [ { "id": "DOID:13580", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13580", "name": "Obstruction of bile duct", "description": "" }, { "id": "DOID:13580", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13580", "name": "bile occlusion", "description": "" } ], "evidence": [ { "id": "13580", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13580" } ] }, { "disease_id": "DOID:2696", "recommended_name": { "id": "DOID:2696", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2696", "name": "Leydig cell tumor", "description": "A sex cord-gonadal stromal tumor that secretes testosterone characterized by excessive proliferation of Leydig cells located_in ovary or testicle." }, "synonyms": [ { "id": "DOID:2696", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2696", "name": "Leydig cell neoplasm", "description": "" } ], "evidence": [ { "id": "2696", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2696" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] }, { "disease_id": "DOID:2921", "recommended_name": { "id": "DOID:2921", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2921", "name": "glomerulonephritis", "description": "A nephritis that causes inflammation of the glomeruli located_in kidney." }, "synonyms": [], "evidence": [ { "id": "2921", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2921" } ] }, { "disease_id": "DOID:3068", "recommended_name": { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "glioblastoma", "description": "A malignant astrocytoma characterized by the presence of small areas of necrotizing tissue that is surrounded by anaplastic cells as well as the presence of hyperplastic blood vessels, and that has_material_basis_in abnormally proliferating cells derives_from multiple cell types including astrocytes and oligondroctyes." }, "synonyms": [ { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "GBM", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "adult glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "grade IV adult Astrocytic tumor", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "primary glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "spongioblastoma multiforme", "description": "" } ], "evidence": [ { "id": "3068", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3068" } ] }, { "disease_id": "DOID:3070", "recommended_name": { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "high grade glioma", "description": "A cell type cancer that has_material_basis_in glial cells and is located in brain or located in spine." }, "synonyms": [ { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "malignant glioma", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "Neuroglial tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "glial cell tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "glioma, malignant", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "malignant Neuroglial tumor", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "GLM1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma, susceptibility to, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "astrocytoma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "ependymoma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma multiforme", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma of brain, familial", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "oligodendroglioma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "subependymoma", "description": "" }, { "id": "MIM:137800", "resource": "MIM", "url": "https://www.omim.org/entry/137800", "name": "Glioma 1", "description": "Glioma 1" } ], "evidence": [ { "id": "3070", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3070" } ] }, { "disease_id": "DOID:3454", "recommended_name": { "id": "DOID:3454", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3454", "name": "brain infarction", "description": "A cerebrovascular disease that is characterized by tissue necrosis located_in the brain, resulting from inadequate blood flow through the brain." }, "synonyms": [], "evidence": [ { "id": "3454", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3454" } ] }, { "disease_id": "DOID:3507", "recommended_name": { "id": "DOID:3507", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3507", "name": "dermatofibrosarcoma protuberans", "description": "A fibrosarcoma that is located_in the dermis laryer of the skin and that begins as a hard nodule and grows slowly." }, "synonyms": [ { "id": "MONDO:0011934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011934", "name": "dermatofibrosarcoma protuberans", "description": "Dermatofibrosarcoma protuberans (DFSP) is a rare infiltrating soft tissue sarcoma, generally of low grade malignancy, arising from the dermis of the skin and characteristically associated with a specific chromosomal translocation t(17;22)." }, { "id": "MONDO:0011934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011934", "name": "DFSP", "description": "" }, { "id": "MONDO:0011934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011934", "name": "dermatofibrosarcoma", "description": "" }, { "id": "MONDO:0011934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011934", "name": "dermatofibrosarcoma protuberans", "description": "" }, { "id": "MONDO:0011934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011934", "name": "familial dermatofibrosarcoma protuberans (subtype)", "description": "" }, { "id": "MONDO:0011934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011934", "name": "giant cell fibroblastoma", "description": "" }, { "id": "MONDO:0011934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011934", "name": "metastatic dermatofibrosarcoma protuberans (subtype)", "description": "" } ], "evidence": [ { "id": "3507", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3507" } ] }, { "disease_id": "DOID:3594", "recommended_name": { "id": "DOID:3594", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3594", "name": "choriocarcinoma", "description": "A placenta cancer that has_material_basis_in trophoblastic cells." }, "synonyms": [ { "id": "DOID:3594", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3594", "name": "Chorioepithelioma", "description": "" } ], "evidence": [ { "id": "3594", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3594" } ] }, { "disease_id": "DOID:4467", "recommended_name": { "id": "DOID:4467", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4467", "name": "clear cell renal cell carcinoma", "description": "A renal cell carcinoma that has_material_basis_in cells that appear very pale or clear when examined under microscope." }, "synonyms": [ { "id": "DOID:4467", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4467", "name": "Clear cell carcinoma of kidney", "description": "" }, { "id": "DOID:4467", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4467", "name": "clear cell kidney carcinoma", "description": "" }, { "id": "DOID:4467", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4467", "name": "conventional (Clear cell) renal cell carcinoma", "description": "" }, { "id": "DOID:4467", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4467", "name": "conventional renal cell carcinoma", "description": "" }, { "id": "DOID:4467", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4467", "name": "renal clear cell carcinoma", "description": "" } ], "evidence": [ { "id": "4467", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4467" } ] }, { "disease_id": "DOID:4586", "recommended_name": { "id": "DOID:4586", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4586", "name": "familial meningioma", "description": "" }, "synonyms": [ { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "familial meningioma", "description": "A meningioma that is transmitted from the parents to an offspring." }, { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "meningioma", "description": "" }, { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "familial meningioma", "description": "" }, { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "hereditary meningioma", "description": "" }, { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "hereditary meningioma (disease)", "description": "" }, { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "meningioma, NF2-related, somatic", "description": "" }, { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "meningioma, SIS-related", "description": "" }, { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "meningioma, familial, susceptibility to", "description": "" }, { "id": "MONDO:0011789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011789", "name": "susceptibility to familial meningioma", "description": "" }, { "id": "MIM:607174", "resource": "MIM", "url": "https://www.omim.org/entry/607174", "name": "Meningioma", "description": "Meningioma" } ], "evidence": [ { "id": "4586", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4586" } ] }, { "disease_id": "DOID:4989", "recommended_name": { "id": "DOID:4989", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4989", "name": "pancreatitis", "description": "A pancreas disease that is characterized by inflammation of the pancreas." }, "synonyms": [ { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "hereditary chronic pancreatitis", "description": "Hereditary chronic pancreatitis (HCP), a rare inherited form of pancreatitis is defined as recurrent acute pancreatitis and/or chronic pancreatitis in two first-degree relatives or 3 or more second-degree relatives in 2 or more generations, for which no predisposing factors are identified. HCP is characterized by irreversible damage to both exocrine and endocrine components of the pancreas." }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "hereditary chronic pancreatitis", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "hereditary pancreatitis", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "HPC", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "Hp", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "PCTT", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "autosomal dominant hereditary pancreatitis", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "familial pancreatitis", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, calcific", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, calcific, included", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic pancreatitis, chronic, susceptibility to, included", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic, protection against", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic, protection against, included", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic, susceptibility to", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, hereditary", "description": "" }, { "id": "MIM:167800", "resource": "MIM", "url": "https://www.omim.org/entry/167800", "name": "Pancreatitis, hereditary", "description": "Pancreatitis, hereditary" } ], "evidence": [ { "id": "4989", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4989" } ] }, { "disease_id": "DOID:5082", "recommended_name": { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "liver cirrhosis", "description": "" }, "synonyms": [ { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "Cirrhosis", "description": "" }, { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "cirrhosis of liver", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis of liver", "description": "A disorder characterized by replacement of the liver parenchyma with fibrous tissue and regenerative nodules. It is usually caused by alcoholism, hepatitis B, and hepatitis C. Complications include the development of ascites, esophageal varices, bleeding, and hepatic encephalopathy." }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis of liver", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "liver cirrhosis", "description": "" } ], "evidence": [ { "id": "5082", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5082" } ] }, { "disease_id": "DOID:5199", "recommended_name": { "id": "DOID:5199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5199", "name": "ureteral obstruction", "description": "" }, "synonyms": [], "evidence": [ { "id": "5199", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5199" } ] }, { "disease_id": "DOID:6432", "recommended_name": { "id": "DOID:6432", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6432", "name": "pulmonary hypertension", "description": "A hypertension characterized by an increase of blood pressure in the pulmonary artery, pulmonary vein or pulmonary capillaries." }, "synonyms": [], "evidence": [ { "id": "6432", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:6432" } ] }, { "disease_id": "DOID:7148", "recommended_name": { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "rheumatoid arthritis", "description": "An arthritis that is an autoimmune disease which attacks healthy cells and tissue located_in joint." }, "synonyms": [ { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "Arthritis or polyarthritis, rheumatic", "description": "" }, { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "atrophic Arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis", "description": "A chronic, systemic autoimmune disorder characterized by inflammation in the synovial membranes and articular surfaces. It manifests primarily as a symmetric, erosive polyarthritis that spares the axial skeleton and is typically associated with the presence in the serum of rheumatoid factor." }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "atrophic arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "RA", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "arthritis or polyarthritis, rheumatic", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "arthritis, rheumatoid", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "autoimmune arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis, progression of", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis, susceptibility to", "description": "" }, { "id": "MIM:180300", "resource": "MIM", "url": "https://www.omim.org/entry/180300", "name": "Rheumatoid arthritis", "description": "Rheumatoid arthritis" } ], "evidence": [ { "id": "7148", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:7148" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Pdgfb", "url": "https://www.uniprot.org/uniprot/P31240", "locus": { "chromosome": "15", "start_pos": 79880075, "end_pos": 79899178, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000000489", "url": "https://www.ensembl.org/id/ENSMUSG00000000489" } ] } } ], "crossref": [ { "id": "ENSMUSG00000000489", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000000489", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00135", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00135", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "18591", "url": "https://www.ncbi.nlm.nih.gov/gene/18591", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P31240", "url": "https://www.ebi.ac.uk/intact/interactors/id:P31240*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006782", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006782", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023581", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023581", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:18591", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18591", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "97528", "url": "http://www.informatics.jax.org/marker/MGI:97528", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "KHTHDKE", "url": "https://omabrowser.org/oma/group/KHTHDKE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5348340at2759", "url": "http://www.orthodb.org/?query=5348340at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11633", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11633", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11633:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11633:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00341", "url": "http://pfam.xfam.org/family/PF00341", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04692", "url": "http://pfam.xfam.org/family/PF04692", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P31240", "url": "http://purl.obolibrary.org/obo/PR_P31240", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1257604", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-186763", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-186763", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-186797", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5673001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6811558", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IZW4", "url": "https://www.uniprot.org/uniprot/A0A0R4IZW4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IZW4-1", "url": "https://www.uniprot.org/uniprot/A0A0R4IZW4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8VHJ1", "url": "https://www.uniprot.org/uniprot/A0A2R8VHJ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8VHJ1-1", "url": "https://www.uniprot.org/uniprot/A0A2R8VHJ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8W6F2", "url": "https://www.uniprot.org/uniprot/A0A2R8W6F2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8W6F2-1", "url": "https://www.uniprot.org/uniprot/A0A2R8W6F2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P31240-1", "url": "https://www.uniprot.org/uniprot/P31240-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAELDLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLGA", "length": 241, "header": "sp|P31240-1|PDGFB_MOUSE Isoform 1 of Platelet-derived growth factor subunit B OS=Mus musculus OX=10090 GN=Pdgfb PE=2 SV=1 CANONICAL=P31240-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IZW4-1", "url": "", "sequence": { "sequence": "MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAELDLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLGA", "length": 241, "header": "tr|A0A0R4IZW4-1|PDGFB_MOUSE Computationally mapped isoform of Platelet-derived growth factor subunit B OS=Mus musculus OX=10090 GN=Pdgfb PE=2 SV=1 CANONICAL=P31240-1" }, "locus": { "chromosome": "15", "start_pos": 79898199, "end_pos": 79881784, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000000500.8", "url": "https://www.ensembl.org/id/ENSMUST00000000500.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000000500.7", "url": "https://www.ensembl.org/id/ENSMUSP00000000500.7" } ] } }, { "isoform_ac": "A0A2R8VHJ1-1", "url": "", "sequence": { "sequence": "MLSDHSIRSFDDLQRLLHRDSVDEDGAELDLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVTRSPGTSREQR", "length": 169, "header": "tr|A0A2R8VHJ1-1|PDGFB_MOUSE Computationally mapped isoform of Platelet-derived growth factor subunit B OS=Mus musculus OX=10090 GN=Pdgfb PE=2 SV=1 CANONICAL=P31240-1" }, "locus": { "chromosome": "15", "start_pos": 79889736, "end_pos": 79884531, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000229912.2", "url": "https://www.ensembl.org/id/ENSMUST00000229912.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000155133.2", "url": "https://www.ensembl.org/id/ENSMUSP00000155133.2" } ] } }, { "isoform_ac": "A0A2R8W6F2-1", "url": "", "sequence": { "sequence": "MTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLID", "length": 49, "header": "tr|A0A2R8W6F2-1|PDGFB_MOUSE Computationally mapped isoform of Platelet-derived growth factor subunit B OS=Mus musculus OX=10090 GN=Pdgfb PE=2 SV=1 CANONICAL=P31240-1" }, "locus": { "chromosome": "15", "start_pos": 79887586, "end_pos": 79886003, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000229795.2", "url": "https://www.ensembl.org/id/ENSMUST00000229795.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000154843.2", "url": "https://www.ensembl.org/id/ENSMUSP00000154843.2" } ] } }, { "isoform_ac": "P31240-1", "url": "", "sequence": { "sequence": "MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAELDLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLGA", "length": 241, "header": "sp|P31240-1|PDGFB_MOUSE Isoform 1 of Platelet-derived growth factor subunit B OS=Mus musculus OX=10090 GN=Pdgfb PE=2 SV=1 CANONICAL=P31240-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 63, "start_aa": "Asn", "end_pos": 63, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn63", "evidence": [ { "id": "P31240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31240#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Platelet-derived growth factor receptor beta regulates migration and DNA synthesis in metanephric mesenchymal cells.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Xu Y.C., Abboud H.E., Arar M., Barnes J.L., Choudhury G.G., Elshihabi I.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "10734101", "url": "https://glygen.org/publication/PubMed/10734101" } ] }, { "title": "Basis of hematopoietic defects in platelet-derived growth factor (PDGF)-B and PDGF beta-receptor null mice.", "journal": "Blood", "date": "2001", "authors": "Kaminski W.E., Raines E.W., Ross R., Betsholtz C., Martin P.J., Hellstrom M., Bowen-Pope D.F., Lindahl P., Crosby J.R., Broudy V.C., Lin N.L., Swolin B.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "11264163", "url": "https://glygen.org/publication/PubMed/11264163" } ] }, { "title": "Obstructive uropathy in mice and humans: potential role for PDGF-D in the progression of tubulointerstitial injury.", "journal": "J. Am. Soc. Nephrol.", "date": "2003", "authors": "Johnson R.J., Truong L., Topouzis S., Alpers C.E., Gilbertson D.G., Hudkins K.L., Ophascharoensuk V., Taneda S.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "14514732", "url": "https://glygen.org/publication/PubMed/14514732" } ] }, { "title": "Endothelial and nonendothelial sources of PDGF-B regulate pericyte recruitment and influence vascular pattern formation in tumors.", "journal": "J. Clin. Invest.", "date": "2003", "authors": "Lindblom P., Betsholtz C., Abramsson A.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "14561699", "url": "https://glygen.org/publication/PubMed/14561699" } ] }, { "title": "PDGF signaling in cells and mice.", "journal": "Cytokine Growth Factor Rev.", "date": "2004", "authors": "Kazlauskas A., Tallquist M.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "15207812", "url": "https://glygen.org/publication/PubMed/15207812" } ] }, { "title": "Insight into the physiological functions of PDGF through genetic studies in mice.", "journal": "Cytokine Growth Factor Rev.", "date": "2004", "authors": "Betsholtz C.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "15207813", "url": "https://glygen.org/publication/PubMed/15207813" } ] }, { "title": "Comprehensive dissection of PDGF-PDGFR signaling pathways in PDGFR genetically defined cells.", "journal": "PLoS ONE", "date": "2008", "authors": "Wang X., Zhang H., Tian Z., Wu E., Galdzicki M., Berger B., Kohane I.S., Moseman A.P., Palmer N.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "19030102", "url": "https://glygen.org/publication/PubMed/19030102" } ] }, { "title": "Structure of the murine c-sis proto-oncogene (Sis, PDGFB) encoding the B chain of platelet-derived growth factor.", "journal": "Genomics", "date": "1991", "authors": "Bonthron D.T., Collins T., Sultan P.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "2045107", "url": "https://glygen.org/publication/PubMed/2045107" } ] }, { "title": "The Role of Platelet-Derived Growth Factor in Focal Segmental Glomerulosclerosis.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2022-11-09", "authors": "Jia Ting, Xu Tong, Smeets Bart, Buhl Eva Miriam, Moeller Marcus Johannes, Floege J\u00fcrgen, Klinkhammer Barbara Mara, Boor Peter", "evidence": [ { "database": "RefSeq", "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" } ], "reference": [ { "type": "PubMed", "id": "36351762", "url": "https://glygen.org/publication/PubMed/36351762" } ] }, { "title": "PDGF-B secreted from skeletal muscle enhances myoblast proliferation and myotube maturation via activation of the PDGFR signaling cascade.", "journal": "Biochemical and biophysical research communications", "date": "2023-01-08", "authors": "Hamaguchi Hiroki, Dohi Kitora, Sakai Takaomi, Taoka Masato, Isobe Toshiaki, Matsui Tsubasa S, Deguchi Shinji, Furuichi Yasuro, Fujii Nobuharu L, Manabe Yasuko", "evidence": [ { "database": "RefSeq", "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" } ], "reference": [ { "type": "PubMed", "id": "36521377", "url": "https://glygen.org/publication/PubMed/36521377" } ] }, { "title": "Lin28b delays vasculature aging by reducing platelet-derived growth factor-beta resistance in senescent vascular smooth muscle cells.", "journal": "Atherosclerosis", "date": "2022-12-13", "authors": "Bian Shihui, Jiang Yu, Dai Zhiyin, Wu Xi, Li Bo, Wang Nan, Bian Wenyan, Zhong Wei", "evidence": [ { "database": "RefSeq", "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" } ], "reference": [ { "type": "PubMed", "id": "36529087", "url": "https://glygen.org/publication/PubMed/36529087" } ] }, { "title": "Perivascular localized cells commit erythropoiesis in PDGF-B-expressing solid tumors.", "journal": "Cancer communications (London, England)", "date": "2023-04-29", "authors": "Hosaka Kayoko, Wang Chenchen, Zhang Shiyue, Lv Xue, Seki Takahiro, Zhang Yin, Jing Xu, Wu Jieyu, Du Qiqiao, He Xingkang, Fan Yulong, Li Xuan, Kondo Makoto, Yoshihara Masahito, Qian Hong, Shi Lihong, Zhu Ping, Xu Yuanfu, Yang Yunlong, Cheng Tao, Cao Yihai", "evidence": [ { "database": "RefSeq", "id": "NP_035187", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035187" } ], "reference": [ { "type": "PubMed", "id": "37120719", "url": "https://glygen.org/publication/PubMed/37120719" } ] }, { "title": "Mice deficient for PDGF B show renal, cardiovascular, and hematological abnormalities.", "journal": "Genes Dev.", "date": "1994", "authors": "Betsholtz C., Larsson E., Gebre-Medhin S., Pekny M., Leveen P., Swolin B.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "7958863", "url": "https://glygen.org/publication/PubMed/7958863" } ] }, { "title": "Pericyte loss and microaneurysm formation in PDGF-B-deficient mice.", "journal": "Science", "date": "1997", "authors": "Betsholtz C., Lindahl P., Johansson B.R., Leveen P.", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "reference": [ { "type": "PubMed", "id": "9211853", "url": "https://glygen.org/publication/PubMed/9211853" } ] } ], "pathway": [ { "id": "mmu:18591", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18591", "resource": "KEGG Pathway" }, { "id": "R-MMU-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-MMU-1257604", "name": "PIP3 activates AKT signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1257604", "resource": "Reactome", "description": "PIP3 activates AKT signaling" }, { "id": "R-MMU-186763", "name": "Downstream signal transduction", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-186763", "resource": "Reactome", "description": "Downstream signal transduction" }, { "id": "R-MMU-186797", "name": "Signaling by PDGF", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-186797", "resource": "Reactome", "description": "Signaling by PDGF" }, { "id": "R-MMU-5673001", "name": "RAF/MAP kinase cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5673001", "resource": "Reactome", "description": "RAF/MAP kinase cascade" }, { "id": "R-MMU-6811558", "name": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6811558", "resource": "Reactome", "description": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "P01127-1", "protein_name": "Platelet-derived growth factor subunit B", "gene_name": "PDGFB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA", "length": 241 }, "evidence": [ { "id": "45228977", "url": "http://www.informatics.jax.org/homology/45228977", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q05028-1", "protein_name": "Platelet-derived growth factor subunit B", "gene_name": "Pdgfb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "LPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAELDLNMTRAHSGVESESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVTRSPGTSREHRAKTPQTRVTVRTVRIRRPPKGKHRKFKHTHDKK", "length": 225 }, "evidence": [ { "id": "45228977", "url": "http://www.informatics.jax.org/homology/45228977", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 96, "go_terms": [ { "name": "positive regulation of glomerular mesangial cell proliferation", "id": "GO:0072126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072126", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "glial cell development", "id": "GO:0021782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021782", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "metanephric glomerular endothelium development", "id": "GO:0072264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072264", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway", "id": "GO:0038033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038033", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of hepatic stellate cell activation", "id": "GO:2000491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000491", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "negative regulation of vascular associated smooth muscle cell differentiation", "id": "GO:1905064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905064", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "neuron remodeling", "id": "GO:0016322", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016322", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "peptidyl-tyrosine phosphorylation", "id": "GO:0018108", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018108", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of protein kinase B signaling", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of protein tyrosine kinase activity", "id": "GO:0061098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061098", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "negative regulation of protein binding", "id": "GO:0032091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032091", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "actin cytoskeleton organization", "id": "GO:0030036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030036", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "synapse assembly", "id": "GO:0007416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007416", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "response to wounding", "id": "GO:0009611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009611", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "activation of protein kinase activity", "id": "GO:0032147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032147", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "activation of protein kinase B activity", "id": "GO:0032148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032148", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of collagen biosynthetic process", "id": "GO:0032967", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032967", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of MAP kinase activity", "id": "GO:0043406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043406", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of vasoconstriction", "id": "GO:0045907", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045907", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "blood vessel morphogenesis", "id": "GO:0048514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048514", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell proliferation", "id": "GO:0048661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050730", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "retina development in camera-type eye", "id": "GO:0060041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060041", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cellular response to growth factor stimulus", "id": "GO:0071363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071363", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "blood vessel development", "id": "GO:0001568", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001568", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell proliferation", "id": "GO:0001938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001938", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of cell-substrate adhesion", "id": "GO:0010811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010811", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase signaling", "id": "GO:0014065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014065", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "vasoconstriction", "id": "GO:0042310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042310", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of cell division", "id": "GO:0051781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051781", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cell chemotaxis", "id": "GO:0060326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "protein kinase C signaling", "id": "GO:0070528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070528", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of vascular associated smooth muscle cell proliferation", "id": "GO:1904707", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904707", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of reactive oxygen species metabolic process", "id": "GO:2000379", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000379", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "retina vasculature development in camera-type eye", "id": "GO:0061298", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061298", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "substrate-dependent cell migration", "id": "GO:0006929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006929", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of blood vessel endothelial cell migration", "id": "GO:0043536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043536", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of fibroblast proliferation", "id": "GO:0048146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048146", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "reactive oxygen species metabolic process", "id": "GO:0072593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072593", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "peptidyl-serine phosphorylation", "id": "GO:0018105", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018105", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "endothelial cell proliferation", "id": "GO:0001935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001935", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of fibroblast migration", "id": "GO:0010763", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010763", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "interleukin-18-mediated signaling pathway", "id": "GO:0035655", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035655", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of DNA replication", "id": "GO:0045740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045740", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of DNA biosynthetic process", "id": "GO:2000573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000573", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "monocyte chemotaxis", "id": "GO:0002548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002548", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase signaling", "id": "GO:0014068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014068", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase activity", "id": "GO:0043552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043552", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of vascular associated smooth muscle cell migration", "id": "GO:1904754", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904754", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cellular response to platelet-derived growth factor stimulus", "id": "GO:0036120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036120", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "embryonic placenta development", "id": "GO:0001892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001892", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "negative regulation of platelet activation", "id": "GO:0010544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010544", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "fibroblast migration", "id": "GO:0010761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010761", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "platelet-derived growth factor receptor signaling pathway", "id": "GO:0048008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048008", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of protein autophosphorylation", "id": "GO:0031954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031954", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "paracrine signaling", "id": "GO:0038001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038001", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of calcium ion import", "id": "GO:0090280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090280", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "eye photoreceptor cell development", "id": "GO:0042462", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042462", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of glomerular filtration", "id": "GO:0003104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003104", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "metanephric glomerular mesangial cell proliferation involved in metanephros development", "id": "GO:0072262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072262", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of mitotic nuclear division", "id": "GO:0045840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045840", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of chemotaxis", "id": "GO:0050921", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050921", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell migration", "id": "GO:0014911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014911", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "branching involved in salivary gland morphogenesis", "id": "GO:0060445", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060445", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of miRNA transcription", "id": "GO:1902895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902895", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of hyaluronan biosynthetic process", "id": "GO:1900127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900127", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "fibroblast growth factor receptor signaling pathway", "id": "GO:0008543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008543", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of cyclin-dependent protein serine/threonine kinase activity", "id": "GO:0045737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045737", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of fibroblast growth factor receptor signaling pathway", "id": "GO:0045743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045743", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "epithelial cell proliferation involved in salivary gland morphogenesis", "id": "GO:0060664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060664", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cardiac vascular smooth muscle cell differentiation", "id": "GO:0060947", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060947", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of mitotic cell cycle, embryonic", "id": "GO:0045977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045977", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "negative regulation of vascular associated smooth muscle cell migration", "id": "GO:1904753", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904753", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of hepatic stellate cell proliferation", "id": "GO:1904899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904899", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cell projection assembly", "id": "GO:0030031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030031", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cellular response to mycophenolic acid", "id": "GO:0071506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071506", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "negative regulation of miRNA transcription", "id": "GO:1902894", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902894", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "negative regulation of phosphatidylinositol biosynthetic process", "id": "GO:0010512", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010512", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway", "id": "GO:0035793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035793", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "metanephric glomerular mesangial cell development", "id": "GO:0072255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072255", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of vascular associated smooth muscle cell dedifferentiation", "id": "GO:1905176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905176", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "positive regulation of metanephric mesenchymal cell migration", "id": "GO:2000591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000591", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "vascular associated smooth muscle cell migration", "id": "GO:1904738", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904738", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "vascular associated smooth muscle cell proliferation", "id": "GO:1990874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990874", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "platelet-derived growth factor receptor binding", "id": "GO:0005161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005161", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "chemoattractant activity", "id": "GO:0042056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042056", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "collagen binding", "id": "GO:0005518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005518", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "growth factor activity", "id": "GO:0008083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008083", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "superoxide-generating NADPH oxidase activator activity", "id": "GO:0016176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016176", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "platelet-derived growth factor binding", "id": "GO:0048407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048407", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "platelet-derived growth factor complex", "id": "GO:1990265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990265", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P31240", "url": "https://www.uniprot.org/uniprot/P31240" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 63, "end_pos": 65, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }