{
"uniprot_canonical_ac": "P30519-1",
"uniprot_ac": "P30519",
"uniprot_id": "HMOX2_HUMAN",
"mass": {
"chemical_mass": 36033.0,
"monoisotopic_mass": 36033.0
},
"refseq": {
"ac": "NP_001273196",
"name": "heme oxygenase 2 isoform a",
"summary": "Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
},
"gene_names": [
{
"name": "HMOX2",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P30519",
"id": "P30519"
},
{
"name": "HMOX2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196",
"id": "NP_001273196"
},
{
"name": "HO-2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196",
"id": "NP_001273196"
},
{
"name": "HO2",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P30519",
"id": "P30519"
}
],
"protein_names": [
{
"name": "Heme oxygenase 2",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P30519"
},
{
"name": "1.14.14.18",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P30519"
},
{
"name": "HO-2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P30519"
},
{
"name": "heme oxygenase (decycling) 2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676",
"id": "NP_001120676"
},
{
"name": "heme oxygenase 2 isoform a",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196",
"id": "NP_001273196"
},
{
"name": "heme oxygenase 2 isoform b",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676",
"id": "NP_001120676"
}
],
"function": [
{
"annotation": "Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron.",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519#function"
},
{
"database": "PubMed",
"id": "7890772",
"url": "https://glygen.org/publication/PubMed/7890772"
},
{
"database": "PubMed",
"id": "1575508",
"url": "https://glygen.org/publication/PubMed/1575508"
}
]
},
{
"annotation": "Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
},
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
}
]
},
{
"annotation": "Heme oxygenase-1 & 2 and their potential contribution in heme induced colorectal carcinogenesis.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
},
{
"database": "PubMed",
"id": "35428017",
"url": "https://glygen.org/publication/PubMed/35428017"
},
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
}
]
},
{
"annotation": "Heme oxygenase-2 (HO-2) binds and buffers labile ferric heme in human embryonic kidney cells.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
},
{
"database": "PubMed",
"id": "34973332",
"url": "https://glygen.org/publication/PubMed/34973332"
},
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
}
]
},
{
"annotation": "Heme oxygenase-2 is post-translationally regulated by heme occupancy in the catalytic site.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
},
{
"database": "PubMed",
"id": "33051205",
"url": "https://glygen.org/publication/PubMed/33051205"
},
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
}
]
},
{
"annotation": "Immune Modulation by Inhibitors of the HO System. Review article Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
},
{
"database": "PubMed",
"id": "33396647",
"url": "https://glygen.org/publication/PubMed/33396647"
},
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
}
]
}
],
"disease": [],
"snv": [
{
"evidence": [
{
"id": "P30519",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P30519"
},
{
"id": "rs1469063084",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469063084"
},
{
"id": "rs1469063084",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1469063084#frequency_tab"
},
{
"id": "rs1469063084",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1469063084"
},
{
"id": "rs1469063084",
"database": "NCI-TCGA",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469063084"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 17,
"end_pos": 17,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "K",
"sequence_mut": "N",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KNS->NNS).",
"chr_id": "16",
"chr_pos": "4505575",
"ref_nt": "G",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "K17",
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease",
"ebi"
]
},
{
"evidence": [
{
"id": "rs1307403235",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1307403235"
},
{
"id": "rs1307403235",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1307403235#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 226,
"end_pos": 226,
"sequence_org": "A",
"sequence_mut": "T",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKA->NKT).",
"chr_id": "16",
"chr_pos": "4508184",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "A226",
"keywords": [
"ebi",
"germline"
]
}
],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "88.15",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "90.89",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "92.58",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "80.81",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "92.4",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "94.48",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "86.74",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "86.33",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "91.04",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "80.45",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "91.69",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "91.67",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "92.5",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P30519"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "HMOX2",
"url": "https://www.uniprot.org/uniprot/P30519",
"locus": {
"chromosome": "CHR_HSCHR16_3_CTG1",
"start_pos": 4512306,
"end_pos": 4476649,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000277424",
"url": "https://www.ensembl.org/id/ENSG00000277424"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000103415",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000103415",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "P30519",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P30519",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "1.14.14.18",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.14.18&UniProtAcc=P30519",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd19165",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19165",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL2546",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2546",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "HMOX2",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HMOX2",
"database": "GeneCards",
"categories": [
"Organism-specific",
"Gene Annotation"
]
},
{
"id": "3163",
"url": "https://www.ncbi.nlm.nih.gov/gene/3163",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "5014",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5014",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P30519",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P30519*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR002051",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR002051",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR016053",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR016053",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR016084",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR016084",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018207",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018207",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:3163",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3163",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "141251",
"url": "http://www.omim.org/entry/141251",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P30519",
"url": "https://www.nextprot.org/entry/NX_P30519",
"database": "neXtProt",
"categories": [
"Organism-specific",
"Protein"
]
},
{
"id": "P30519",
"url": "https://oglcnac.org/atlas/detail/P30519",
"database": "O-GlcNAc Atlas",
"categories": [
"Glycoproteomics"
]
},
{
"id": "P30519",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P30519",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "ANRAFEY",
"url": "https://omabrowser.org/oma/group/ANRAFEY/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "1366343at2759",
"url": "http://www.orthodb.org/?query=1366343at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR10720",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10720",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR10720:SF2",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10720:SF2",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "2Q32",
"url": "https://www.rcsb.org/structure/2Q32",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2QPP",
"url": "https://www.rcsb.org/structure/2QPP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2RGZ",
"url": "https://www.rcsb.org/structure/2RGZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4WMH",
"url": "https://www.rcsb.org/structure/4WMH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5UC8",
"url": "https://www.rcsb.org/structure/5UC8",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5UC9",
"url": "https://www.rcsb.org/structure/5UC9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5UCA",
"url": "https://www.rcsb.org/structure/5UCA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF01126",
"url": "http://pfam.xfam.org/family/PF01126",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P30519",
"url": "https://pharos.nih.gov/targets/P30519",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P30519",
"url": "http://purl.obolibrary.org/obo/PR_P30519",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-6798695",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "21764",
"url": "https://www.rhea-db.org/rhea/21764",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A087WT44",
"url": "https://www.uniprot.org/uniprot/A0A087WT44",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087WT44-1",
"url": "https://www.uniprot.org/uniprot/A0A087WT44-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A1B0GXH0",
"url": "https://www.uniprot.org/uniprot/A0A1B0GXH0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A1B0GXH0-1",
"url": "https://www.uniprot.org/uniprot/A0A1B0GXH0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L159",
"url": "https://www.uniprot.org/uniprot/I3L159",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L159-1",
"url": "https://www.uniprot.org/uniprot/I3L159-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L1F5",
"url": "https://www.uniprot.org/uniprot/I3L1F5",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L1F5-1",
"url": "https://www.uniprot.org/uniprot/I3L1F5-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L1Y2",
"url": "https://www.uniprot.org/uniprot/I3L1Y2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L1Y2-1",
"url": "https://www.uniprot.org/uniprot/I3L1Y2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L276",
"url": "https://www.uniprot.org/uniprot/I3L276",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L276-1",
"url": "https://www.uniprot.org/uniprot/I3L276-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L463",
"url": "https://www.uniprot.org/uniprot/I3L463",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L463-1",
"url": "https://www.uniprot.org/uniprot/I3L463-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L4P8",
"url": "https://www.uniprot.org/uniprot/I3L4P8",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L4P8-1",
"url": "https://www.uniprot.org/uniprot/I3L4P8-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P30519-1",
"url": "https://www.uniprot.org/uniprot/P30519-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P30519-2",
"url": "https://www.uniprot.org/uniprot/P30519-2",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM",
"length": 316,
"header": "sp|P30519-1|HMOX2_HUMAN Isoform 1 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=2 CANONICAL=P30519-1"
},
"isoforms": [
{
"isoform_ac": "A0A087WT44-1",
"url": "",
"sequence": {
"sequence": "MESRSVAQAGVQWISLAHCSLHLLGSRDSPASASCVAGITGPEEREQQEPHPAAMSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM",
"length": 370,
"header": "tr|A0A087WT44-1|A0A087WT44_HUMAN Computationally mapped isoform of heme oxygenase (biliverdin-producing) OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=1 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "16",
"start_pos": 4509753,
"end_pos": 4496146,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000613539.1",
"url": "https://www.ensembl.org/id/ENST00000613539.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000477572.1",
"url": "https://www.ensembl.org/id/ENSP00000477572.1"
}
]
}
},
{
"isoform_ac": "A0A1B0GXH0-1",
"url": "",
"sequence": {
"sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAA",
"length": 131,
"header": "tr|A0A1B0GXH0-1|A0A1B0GXH0_HUMAN Computationally mapped isoform of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=1 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "CHR_HSCHR16_3_CTG1",
"start_pos": 4509860,
"end_pos": 4507484,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000631697.1",
"url": "https://www.ensembl.org/id/ENST00000631697.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000488477.1",
"url": "https://www.ensembl.org/id/ENSP00000488477.1"
}
]
}
},
{
"isoform_ac": "I3L159-1",
"url": "",
"sequence": {
"sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEY",
"length": 229,
"header": "tr|I3L159-1|HMOX2_HUMAN Computationally mapped isoform of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=1 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "16",
"start_pos": 4508195,
"end_pos": 4505525,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000570445.5",
"url": "https://www.ensembl.org/id/ENST00000570445.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000458592.1",
"url": "https://www.ensembl.org/id/ENSP00000458592.1"
}
]
}
},
{
"isoform_ac": "I3L1F5-1",
"url": "",
"sequence": {
"sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELD",
"length": 238,
"header": "tr|I3L1F5-1|HMOX2_HUMAN Computationally mapped isoform of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=1 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "16",
"start_pos": 4509429,
"end_pos": 4505525,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000575051.5",
"url": "https://www.ensembl.org/id/ENST00000575051.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000458797.1",
"url": "https://www.ensembl.org/id/ENSP00000458797.1"
}
]
}
},
{
"isoform_ac": "I3L1Y2-1",
"url": "",
"sequence": {
"sequence": "XQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGRSVCPELPSWGRCSRRLH",
"length": 110,
"header": "tr|I3L1Y2-1|HMOX2_HUMAN Computationally mapped isoform of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=1 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "16",
"start_pos": 4509595,
"end_pos": 4508059,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000570622.1",
"url": "https://www.ensembl.org/id/ENST00000570622.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000459203.1",
"url": "https://www.ensembl.org/id/ENSP00000459203.1"
}
]
}
},
{
"isoform_ac": "I3L276-1",
"url": "",
"sequence": {
"sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALT",
"length": 110,
"header": "tr|I3L276-1|I3L276_HUMAN Computationally mapped isoform of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=1 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "16",
"start_pos": 4507838,
"end_pos": 4505525,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000572812.5",
"url": "https://www.ensembl.org/id/ENST00000572812.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000459445.1",
"url": "https://www.ensembl.org/id/ENSP00000459445.1"
}
]
}
},
{
"isoform_ac": "I3L463-1",
"url": "",
"sequence": {
"sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQ",
"length": 132,
"header": "tr|I3L463-1|HMOX2_HUMAN Computationally mapped isoform of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=1 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "CHR_HSCHR16_3_CTG1",
"start_pos": 4509863,
"end_pos": 4507484,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000632175.1",
"url": "https://www.ensembl.org/id/ENST00000632175.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000488598.1",
"url": "https://www.ensembl.org/id/ENSP00000488598.1"
}
]
}
},
{
"isoform_ac": "I3L4P8-1",
"url": "",
"sequence": {
"sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKA",
"length": 130,
"header": "tr|I3L4P8-1|HMOX2_HUMAN Computationally mapped isoform of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=8 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "16",
"start_pos": 4507898,
"end_pos": 4505525,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000574466.5",
"url": "https://www.ensembl.org/id/ENST00000574466.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000461428.1",
"url": "https://www.ensembl.org/id/ENSP00000461428.1"
}
]
}
},
{
"isoform_ac": "P30519-1",
"url": "",
"sequence": {
"sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM",
"length": 316,
"header": "sp|P30519-1|HMOX2_HUMAN Isoform 1 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=2 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "16",
"start_pos": 4509753,
"end_pos": 4505525,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000219700.10",
"url": "https://www.ensembl.org/id/ENST00000219700.10"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000219700.6",
"url": "https://www.ensembl.org/id/ENSP00000219700.6"
}
]
}
},
{
"isoform_ac": "P30519-2",
"url": "",
"sequence": {
"sequence": "MADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM",
"length": 287,
"header": "sp|P30519-2|HMOX2_HUMAN Isoform 2 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=2 CANONICAL=P30519-1"
},
"locus": {
"chromosome": "16",
"start_pos": 4509753,
"end_pos": 4506896,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000575120.5",
"url": "https://www.ensembl.org/id/ENST00000575120.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000460926.1",
"url": "https://www.ensembl.org/id/ENSP00000460926.1"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 242,
"start_aa": "Ser",
"end_pos": 242,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser242",
"evidence": [
{
"id": "P30519",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P30519"
},
{
"id": "34019948",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34019948"
},
{
"id": "34229054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34229054"
},
{
"id": "29351928",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29351928"
},
{
"id": "P30519",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/P30519"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 243,
"start_aa": "Thr",
"end_pos": 243,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr243",
"evidence": [
{
"id": "P30519",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P30519"
},
{
"id": "34019948",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34019948"
},
{
"id": "34229054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34229054"
},
{
"id": "29351928",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29351928"
},
{
"id": "P30519",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/P30519"
}
]
}
],
"phosphorylation": [
{
"start_pos": 2,
"end_pos": 2,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P30519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30519"
}
],
"site_lbl": "Ser2"
},
{
"start_pos": 79,
"end_pos": 79,
"kinase_uniprot_canonical_ac": "P68400-1",
"kinase_gene_name": "CSNK2A1",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P30519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30519"
},
{
"database": "PubMed",
"id": "14527438",
"url": "https://glygen.org/publication/PubMed/14527438"
}
],
"site_lbl": "Ser79"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Interaction of the small G protein RhoA with the C terminus of human phospholipase D1.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Yamazaki M, Zhang Y, Watanabe H, Yokozeki T, Ohno S, Kaibuchi K, Shibata H, Mukai H, Ono Y, Frohman MA, Kanaho Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10037681",
"url": "https://glygen.org/publication/PubMed/10037681"
}
]
},
{
"title": "Expression, purification and crystallization of a BH domain from the GTPase regulatory protein associated with focal adhesion kinase.",
"journal": "Acta crystallographica. Section D, Biological crystallography",
"date": "1999",
"authors": "Sheffield PJ, Derewenda U, Taylor J, Parsons TJ, Derewenda ZS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10232922",
"url": "https://glygen.org/publication/PubMed/10232922"
}
]
},
{
"title": "Transport of monoglucuronosyl and bisglucuronosyl bilirubin by recombinant human and rat multidrug resistance protein 2.",
"journal": "Hepatology (Baltimore, Md.)",
"date": "1999",
"authors": "Kamisako T, Leier I, Cui Y, Konig J, Buchholz U, Hummel-Eisenbeiss J, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10421658",
"url": "https://glygen.org/publication/PubMed/10421658"
}
]
},
{
"title": "The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Joberty G, Perlungher RR, Macara IG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10490598",
"url": "https://glygen.org/publication/PubMed/10490598"
}
]
},
{
"title": "Dependence of Dbl and Dbs transformation on MEK and NF-kappaB activation.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Whitehead IP, Lambert QT, Glaven JA, Abe K, Rossman KL, Mahon GM, Trzaskos JM, Kay R, Campbell SL, Der CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10523665",
"url": "https://glygen.org/publication/PubMed/10523665"
}
]
},
{
"title": "Biological and regulatory properties of Vav-3, a new member of the Vav family of oncoproteins.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Movilla N, Bustelo XR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10523675",
"url": "https://glygen.org/publication/PubMed/10523675"
}
]
},
{
"title": "Rho-specific binding and guanine nucleotide exchange catalysis by KIAA0380, a dbl family member.",
"journal": "FEBS letters",
"date": "1999",
"authors": "Rumenapp U, Blomquist A, Schworer G, Schablowski H, Psoma A, Jakobs KH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10526156",
"url": "https://glygen.org/publication/PubMed/10526156"
}
]
},
{
"title": "Human ECT2 is an exchange factor for Rho GTPases, phosphorylated in G2/M phases, and involved in cytokinesis.",
"journal": "The Journal of cell biology",
"date": "1999",
"authors": "Tatsumoto T, Xie X, Blumenthal R, Okamoto I, Miki T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10579713",
"url": "https://glygen.org/publication/PubMed/10579713"
}
]
},
{
"title": "Covalent modification of all members of human cullin family proteins by NEDD8.",
"journal": "Oncogene",
"date": "1999",
"authors": "Hori T, Osaka F, Chiba T, Miyamoto C, Okabayashi K, Shimbara N, Kato S, Tanaka K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "10597293",
"url": "https://glygen.org/publication/PubMed/10597293"
}
]
},
{
"title": "The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.",
"journal": "Molecular cell",
"date": "1999",
"authors": "Maesaki R, Ihara K, Shimizu T, Kuroda S, Kaibuchi K, Hakoshima T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10619026",
"url": "https://glygen.org/publication/PubMed/10619026"
}
]
},
{
"title": "Initial-rate kinetics of the flavin reductase reaction catalysed by human biliverdin-IXbeta reductase (BVR-B).",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Cunningham O, Gore MG, Mantle TJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10620517",
"url": "https://glygen.org/publication/PubMed/10620517"
}
]
},
{
"title": "A novel human organic anion transporting polypeptide localized to the basolateral hepatocyte membrane.",
"journal": "American journal of physiology. Gastrointestinal and liver physiology",
"date": "2000",
"authors": "Konig J, Cui Y, Nies AT, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10644574",
"url": "https://glygen.org/publication/PubMed/10644574"
}
]
},
{
"title": "Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA.",
"journal": "Human molecular genetics",
"date": "2000",
"authors": "Prakash SK, Paylor R, Jenna S, Lamarche-Vane N, Armstrong DL, Xu B, Mancini MA, Zoghbi HY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10699171",
"url": "https://glygen.org/publication/PubMed/10699171"
}
]
},
{
"title": "Molecular cloning, expression characterization, and mapping of a novel putative inhibitor of rho GTPase activity, RTKN, to D2S145-D2S286.",
"journal": "Genomics",
"date": "2000",
"authors": "Fu Q, Yu L, Liu Q, Zhang J, Zhang H, Zhao S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "10873388",
"url": "https://glygen.org/publication/PubMed/10873388"
}
]
},
{
"title": "Recent advances in bilirubin metabolism research: the molecular mechanism of hepatocyte bilirubin transport and its clinical relevance.",
"journal": "Journal of gastroenterology",
"date": "2000",
"authors": "Kamisako T, Kobayashi Y, Takeuchi K, Ishihara T, Higuchi K, Tanaka Y, Gabazza EC, Adachi Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11023036",
"url": "https://glygen.org/publication/PubMed/11023036"
}
]
},
{
"title": "Characterization of p190RhoGEF, a RhoA-specific guanine nucleotide exchange factor that interacts with microtubules.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "van Horck FP, Ahmadian MR, Haeusler LC, Moolenaar WH, Kranenburg O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11058585",
"url": "https://glygen.org/publication/PubMed/11058585"
}
]
},
{
"title": "Identification and characterization of a novel Rho-specific guanine nucleotide exchange factor.",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Blomquist A, Schworer G, Schablowski H, Psoma A, Lehnen M, Jakobs KH, Rumenapp U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11085924",
"url": "https://glygen.org/publication/PubMed/11085924"
}
]
},
{
"title": "Hepatic uptake of bilirubin and its conjugates by the human organic anion transporter SLC21A6.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Cui Y, Konig J, Leier I, Buchholz U, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11134001",
"url": "https://glygen.org/publication/PubMed/11134001"
}
]
},
{
"title": "Functional role for the class IX myosin myr5 in epithelial cell infection by Shigella flexneri.",
"journal": "Cellular microbiology",
"date": "2000",
"authors": "Graf B, Bahler M, Hilpela P, Bowe C, Adam T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11207612",
"url": "https://glygen.org/publication/PubMed/11207612"
}
]
},
{
"title": "A human mitochondrial ferritin encoded by an intronless gene.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Levi S, Corsi B, Bosisio M, Invernizzi R, Volz A, Sanford D, Arosio P, Drysdale J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "11323407",
"url": "https://glygen.org/publication/PubMed/11323407"
}
]
},
{
"title": "Leukemia-associated Rho guanine nucleotide exchange factor, a Dbl family protein found mutated in leukemia, causes transformation by activation of RhoA.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Reuther GW, Lambert QT, Booden MA, Wennerberg K, Becknell B, Marcucci G, Sondek J, Caligiuri MA, Der CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11373293",
"url": "https://glygen.org/publication/PubMed/11373293"
}
]
},
{
"title": "Isolation of a novel human gene, ARHGAP9, encoding a rho-GTPase activating protein.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Furukawa Y, Kawasoe T, Daigo Y, Nishiwaki T, Ishiguro H, Takahashi M, Kitayama J, Nakamura Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11396949",
"url": "https://glygen.org/publication/PubMed/11396949"
}
]
},
{
"title": "Affinity of human serum albumin for bilirubin varies with albumin concentration and buffer composition: results of a novel ultrafiltration method.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Weisiger RA, Ostrow JD, Koehler RK, Webster CC, Mukerjee P, Pascolo L, Tiribelli C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11397817",
"url": "https://glygen.org/publication/PubMed/11397817"
}
]
},
{
"title": "Rich, a rho GTPase-activating protein domain-containing protein involved in signaling by Cdc42 and Rac1.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Richnau N, Aspenstrom P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11431473",
"url": "https://glygen.org/publication/PubMed/11431473"
}
]
},
{
"title": "PKNbeta interacts with the SH3 domains of Graf and a novel Graf related protein, Graf2, which are GTPase activating proteins for Rho family.",
"journal": "Journal of biochemistry",
"date": "2001",
"authors": "Shibata H, Oishi K, Yamagiwa A, Matsumoto M, Mukai H, Ono Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11432776",
"url": "https://glygen.org/publication/PubMed/11432776"
}
]
},
{
"title": "The albumin binding of unconjugated bilirubin in serum.",
"journal": "Clinical biochemistry",
"date": "1975",
"authors": "Griffiths WC, Diamond I, Dextraze P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "1157293",
"url": "https://glygen.org/publication/PubMed/1157293"
}
]
},
{
"title": "Distinct roles for the two Rho GDP/GTP exchange factor domains of kalirin in regulation of neurite growth and neuronal morphology.",
"journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience",
"date": "2001",
"authors": "Penzes P, Johnson RC, Kambampati V, Mains RE, Eipper BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11606631",
"url": "https://glygen.org/publication/PubMed/11606631"
}
]
},
{
"title": "Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway.",
"journal": "Cell",
"date": "2001",
"authors": "Wong K, Ren XR, Huang YZ, Xie Y, Liu G, Saito H, Tang H, Wen L, Brady-Kalnay SM, Mei L, Wu JY, Xiong WC, Rao Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11672528",
"url": "https://glygen.org/publication/PubMed/11672528"
}
]
},
{
"title": "Chondrocyte-derived ezrin-like domain containing protein (CDEP), a rho guanine nucleotide exchange factor, is inducible in chondrocytes by parathyroid hormone and cyclic AMP and has transforming activity in NIH3T3 cells.",
"journal": "Osteoarthritis and cartilage",
"date": "2001",
"authors": "Koyano Y, Kawamoto T, Kikuchi A, Shen M, Kuruta Y, Tsutsumi S, Fujimoto K, Noshiro M, Fujii K, Kato Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11680691",
"url": "https://glygen.org/publication/PubMed/11680691"
}
]
},
{
"title": "Kinectin is a key effector of RhoG microtubule-dependent cellular activity.",
"journal": "Molecular and cellular biology",
"date": "2001",
"authors": "Vignal E, Blangy A, Martin M, Gauthier-Rouviere C, Fort P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11689693",
"url": "https://glygen.org/publication/PubMed/11689693"
}
]
},
{
"title": "The gene for a new brain specific RhoA exchange factor maps to the highly unstable chromosomal region 1p36.2-1p36.3.",
"journal": "Oncogene",
"date": "2001",
"authors": "De Toledo M, Coulon V, Schmidt S, Fort P, Blangy A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11704860",
"url": "https://glygen.org/publication/PubMed/11704860"
}
]
},
{
"title": "Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Krugmann S, Anderson KE, Ridley SH, Risso N, McGregor A, Coadwell J, Davidson K, Eguinoa A, Ellson CD, Lipp P, Manifava M, Ktistakis N, Painter G, Thuring JW, Cooper MA, Lim ZY, Holmes AB, Dove SK, Michell RH, Grewal A, Nazarian A, Erdjument-Bromage H, Tempst P, Stephens LR, Hawkins PT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11804589",
"url": "https://glygen.org/publication/PubMed/11804589"
}
]
},
{
"title": "ARAP1: a point of convergence for Arf and Rho signaling.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Miura K, Jacques KM, Stauffer S, Kubosaki A, Zhu K, Hirsch DS, Resau J, Zheng Y, Randazzo PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11804590",
"url": "https://glygen.org/publication/PubMed/11804590"
}
]
},
{
"title": "Distinct role of phosphatidylinositol 3-kinase and Rho family GTPases in Vav3-induced cell transformation, cell motility, and morphological changes.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Sachdev P, Zeng L, Wang LH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11884391",
"url": "https://glygen.org/publication/PubMed/11884391"
}
]
},
{
"title": "Nucleotide exchange factor GEF-H1 mediates cross-talk between microtubules and the actin cytoskeleton.",
"journal": "Nature cell biology",
"date": "2002",
"authors": "Krendel M, Zenke FT, Bokoch GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "11912491",
"url": "https://glygen.org/publication/PubMed/11912491"
}
]
},
{
"title": "A mammalian Rho-specific guanine-nucleotide exchange factor (p164-RhoGEF) without a pleckstrin homology domain.",
"journal": "The Biochemical journal",
"date": "2002",
"authors": "Rumenapp U, Freichel-Blomquist A, Wittinghofer B, Jakobs KH, Wieland T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12071859",
"url": "https://glygen.org/publication/PubMed/12071859"
}
]
},
{
"title": "A novel Rho GTPase-activating-protein interacts with Gem, a member of the Ras superfamily of GTPases.",
"journal": "The Biochemical journal",
"date": "2002",
"authors": "Aresta S, de Tand-Heim MF, Beranger F, de Gunzburg J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12093360",
"url": "https://glygen.org/publication/PubMed/12093360"
}
]
},
{
"title": "The novel Rho-GTPase activating gene MEGAP/ srGAP3 has a putative role in severe mental retardation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Endris V, Wogatzky B, Leimer U, Bartsch D, Zatyka M, Latif F, Maher ER, Tariverdian G, Kirsch S, Karch D, Rappold GA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12195014",
"url": "https://glygen.org/publication/PubMed/12195014"
}
]
},
{
"title": "The RhoA-binding protein, rhophilin-2, regulates actin cytoskeleton organization.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Peck JW, Oberst M, Bouker KB, Bowden E, Burbelo PD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12221077",
"url": "https://glygen.org/publication/PubMed/12221077"
}
]
},
{
"title": "XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Arthur WT, Ellerbroek SM, Der CJ, Burridge K, Wennerberg K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12221096",
"url": "https://glygen.org/publication/PubMed/12221096"
}
]
},
{
"title": "The neutrophil lipocalin NGAL is a bacteriostatic agent that interferes with siderophore-mediated iron acquisition.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Goetz DH, Holmes MA, Borregaard N, Bluhm ME, Raymond KN, Strong RK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "12453412",
"url": "https://glygen.org/publication/PubMed/12453412"
}
]
},
{
"title": "CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Zheng J, Yang X, Harrell JM, Ryzhikov S, Shim EH, Lykke-Andersen K, Wei N, Sun H, Kobayashi R, Zhang H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "12504026",
"url": "https://glygen.org/publication/PubMed/12504026"
}
]
},
{
"title": "Deleted in liver cancer (DLC) 2 encodes a RhoGAP protein with growth suppressor function and is underexpressed in hepatocellular carcinoma.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Ching YP, Wong CM, Chan SF, Leung TH, Ng DC, Jin DY, Ng IO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12531887",
"url": "https://glygen.org/publication/PubMed/12531887"
}
]
},
{
"title": "ArhGAP15, a novel human RacGAP protein with GTPase binding property.",
"journal": "FEBS letters",
"date": "2003",
"authors": "Seoh ML, Ng CH, Yong J, Lim L, Leung T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12650940",
"url": "https://glygen.org/publication/PubMed/12650940"
}
]
},
{
"title": "p250GAP, a novel brain-enriched GTPase-activating protein for Rho family GTPases, is involved in the N-methyl-d-aspartate receptor signaling.",
"journal": "Molecular biology of the cell",
"date": "2003",
"authors": "Nakazawa T, Watabe AM, Tezuka T, Yoshida Y, Yokoyama K, Umemori H, Inoue A, Okabe S, Manabe T, Yamamoto T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12857875",
"url": "https://glygen.org/publication/PubMed/12857875"
}
]
},
{
"title": "Characterization of the Rac-GAP (Rac-GTPase-activating protein) activity of beta2-chimaerin, a 'non-protein kinase C' phorbol ester receptor.",
"journal": "The Biochemical journal",
"date": "2003",
"authors": "Caloca MJ, Wang H, Kazanietz MG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "12877655",
"url": "https://glygen.org/publication/PubMed/12877655"
}
]
},
{
"title": "The expression and functional characterization of ABCG2 in brain endothelial cells and vessels.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2003",
"authors": "Zhang W, Mojsilovic-Petrovic J, Andrade MF, Zhang H, Ball M, Stanimirovic DB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "12958161",
"url": "https://glygen.org/publication/PubMed/12958161"
}
]
},
{
"title": "Carbon monoxide specifically inhibits cytochrome c oxidase of human mitochondrial respiratory chain.",
"journal": "Pharmacology & toxicology",
"date": "2003",
"authors": "Alonso JR, Cardellach F, Lopez S, Casademont J, Miro O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "12969439",
"url": "https://glygen.org/publication/PubMed/12969439"
}
]
},
{
"title": "G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1: regulation of cell shape and reactive oxygen species production.",
"journal": "Circulation research",
"date": "2003",
"authors": "Niu J, Profirovic J, Pan H, Vaiskunaite R, Voyno-Yasenetskaya T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "14512443",
"url": "https://glygen.org/publication/PubMed/14512443"
}
]
},
{
"title": "Carbon monoxide neurotransmission activated by CK2 phosphorylation of heme oxygenase-2.",
"journal": "Neuron",
"date": "2003",
"authors": "Boehning D, Moon C, Sharma S, Hurt KJ, Hester LD, Ronnett GV, Shugar D, Snyder SH",
"evidence": [
{
"database": "iPTMnet",
"id": "P30519-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30519-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "14527438",
"url": "https://glygen.org/publication/PubMed/14527438"
}
]
},
{
"title": "Multidrug resistance mediated by the breast cancer resistance protein BCRP (ABCG2).",
"journal": "Oncogene",
"date": "2003",
"authors": "Doyle L, Ross DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "14576842",
"url": "https://glygen.org/publication/PubMed/14576842"
}
]
},
{
"title": "Characterization of oligomeric human half-ABC transporter ATP-binding cassette G2.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Xu J, Liu Y, Yang Y, Bates S, Zhang JT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "15001581",
"url": "https://glygen.org/publication/PubMed/15001581"
}
]
},
{
"title": "DEF6, a novel PH-DH-like domain protein, is an upstream activator of the Rho GTPases Rac1, Cdc42, and RhoA.",
"journal": "Experimental cell research",
"date": "2004",
"authors": "Mavrakis KJ, McKinlay KJ, Jones P, Sablitzky F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15023524",
"url": "https://glygen.org/publication/PubMed/15023524"
}
]
},
{
"title": "The stem cell marker Bcrp/ABCG2 enhances hypoxic cell survival through interactions with heme.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Krishnamurthy P, Ross DD, Nakanishi T, Bailey-Dell K, Zhou S, Mercer KE, Sarkadi B, Sorrentino BP, Schuetz JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "15044468",
"url": "https://glygen.org/publication/PubMed/15044468"
}
]
},
{
"title": "BPGAP1 interacts with cortactin and facilitates its translocation to cell periphery for enhanced cell migration.",
"journal": "Molecular biology of the cell",
"date": "2004",
"authors": "Lua BL, Low BC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15064355",
"url": "https://glygen.org/publication/PubMed/15064355"
}
]
},
{
"title": "Scambio, a novel guanine nucleotide exchange factor for Rho.",
"journal": "Molecular cancer",
"date": "2004",
"authors": "Curtis C, Hemmeryckx B, Haataja L, Senadheera D, Groffen J, Heisterkamp N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15107133",
"url": "https://glygen.org/publication/PubMed/15107133"
}
]
},
{
"title": "Crystal structure and biochemical properties of the human mitochondrial ferritin and its mutant Ser144Ala.",
"journal": "Journal of molecular biology",
"date": "2004",
"authors": "Langlois d'Estaintot B, Santambrogio P, Granier T, Gallois B, Chevalier JM, Precigoux G, Levi S, Arosio P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "15201052",
"url": "https://glygen.org/publication/PubMed/15201052"
}
]
},
{
"title": "The human multidrug-resistance-associated protein MRP1 mediates ATP-dependent transport of unconjugated bilirubin.",
"journal": "The Biochemical journal",
"date": "2004",
"authors": "Rigato I, Pascolo L, Fernetti C, Ostrow JD, Tiribelli C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "15245331",
"url": "https://glygen.org/publication/PubMed/15245331"
}
]
},
{
"title": "A vascular cell-restricted RhoGAP, p73RhoGAP, is a key regulator of angiogenesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2004",
"authors": "Su ZJ, Hahn CN, Goodall GJ, Reck NM, Leske AF, Davy A, Kremmidiotis G, Vadas MA, Gamble JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15302923",
"url": "https://glygen.org/publication/PubMed/15302923"
}
]
},
{
"title": "Vilse, a conserved Rac/Cdc42 GAP mediating Robo repulsion in tracheal cells and axons.",
"journal": "Genes & development",
"date": "2004",
"authors": "Lundstrom A, Gallio M, Englund C, Steneberg P, Hemphala J, Aspenstrom P, Keleman K, Falileeva L, Dickson BJ, Samakovlis C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15342493",
"url": "https://glygen.org/publication/PubMed/15342493"
}
]
},
{
"title": "WGEF is a novel RhoGEF expressed in intestine, liver, heart, and kidney.",
"journal": "Biochemical and biophysical research communications",
"date": "2004",
"authors": "Wang Y, Suzuki H, Yokoo T, Tada-Iida K, Kihara R, Miura M, Watanabe K, Sone H, Shimano H, Toyoshima H, Yamada N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15485661",
"url": "https://glygen.org/publication/PubMed/15485661"
}
]
},
{
"title": "Lipocalin 2 mediates an innate immune response to bacterial infection by sequestrating iron.",
"journal": "Nature",
"date": "2004",
"authors": "Flo TH, Smith KD, Sato S, Rodriguez DJ, Holmes MA, Strong RK, Akira S, Aderem A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "15531878",
"url": "https://glygen.org/publication/PubMed/15531878"
}
]
},
{
"title": "Structure of the Cand1-Cul1-Roc1 complex reveals regulatory mechanisms for the assembly of the multisubunit cullin-dependent ubiquitin ligases.",
"journal": "Cell",
"date": "2004",
"authors": "Goldenberg SJ, Cascio TC, Shumway SD, Garbutt KC, Liu J, Xiong Y, Zheng N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "15537541",
"url": "https://glygen.org/publication/PubMed/15537541"
}
]
},
{
"title": "TIM, a Dbl-related protein, regulates cell shape and cytoskeletal organization in a Rho-dependent manner.",
"journal": "Cellular signalling",
"date": "2005",
"authors": "Xie X, Chang SW, Tatsumoto T, Chan AM, Miki T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15601624",
"url": "https://glygen.org/publication/PubMed/15601624"
}
]
},
{
"title": "Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Lavelin I, Geiger B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15611138",
"url": "https://glygen.org/publication/PubMed/15611138"
}
]
},
{
"title": "Human heme oxygenase-2: characterization and expression of a full-length cDNA and evidence suggesting that the two HO-2 transcripts may differ by choice of polyadenylation signal.",
"journal": "Arch. Biochem. Biophys.",
"date": "1992",
"authors": "McCoubrey WK Jr, Ewing JF, Maines MD",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"reference": [
{
"type": "PubMed",
"id": "1575508",
"url": "https://glygen.org/publication/PubMed/1575508"
}
]
},
{
"title": "Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Heo J, Thapar R, Campbell SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15850391",
"url": "https://glygen.org/publication/PubMed/15850391"
}
]
},
{
"title": "Structural basis of Rho GTPase-mediated activation of the formin mDia1.",
"journal": "Molecular cell",
"date": "2005",
"authors": "Otomo T, Otomo C, Tomchick DR, Machius M, Rosen MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "15866170",
"url": "https://glygen.org/publication/PubMed/15866170"
}
]
},
{
"title": "GrinchGEF--a novel Rho-specific guanine nucleotide exchange factor.",
"journal": "Biochemical and biophysical research communications",
"date": "2005",
"authors": "Winkler S, Mohl M, Wieland T, Lutz S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16112081",
"url": "https://glygen.org/publication/PubMed/16112081"
}
]
},
{
"title": "The t complex-encoded GTPase-activating protein Tagap1 acts as a transmission ratio distorter in mice.",
"journal": "Nature genetics",
"date": "2005",
"authors": "Bauer H, Willert J, Koschorz B, Herrmann BG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16116428",
"url": "https://glygen.org/publication/PubMed/16116428"
}
]
},
{
"title": "Identification of an intestinal heme transporter.",
"journal": "Cell",
"date": "2005",
"authors": "Shayeghi M, Latunde-Dada GO, Oakhill JS, Laftah AH, Takeuchi K, Halliday N, Khan Y, Warley A, McCann FE, Hider RC, Frazer DM, Anderson GJ, Vulpe CD, Simpson RJ, McKie AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16143108",
"url": "https://glygen.org/publication/PubMed/16143108"
}
]
},
{
"title": "ARHGAP10 is necessary for alpha-catenin recruitment at adherens junctions and for Listeria invasion.",
"journal": "Nature cell biology",
"date": "2005",
"authors": "Sousa S, Cabanes D, Archambaud C, Colland F, Lemichez E, Popoff M, Boisson-Dupuis S, Gouin E, Lecuit M, Legrain P, Cossart P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16184169",
"url": "https://glygen.org/publication/PubMed/16184169"
}
]
},
{
"title": "Deleted in liver cancer 2 (DLC2) suppresses cell transformation by means of inhibition of RhoA activity.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Leung TH, Ching YP, Yam JW, Wong CM, Yau TO, Jin DY, Ng IO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16217026",
"url": "https://glygen.org/publication/PubMed/16217026"
}
]
},
{
"title": "Recombinant expression and functional characterization of human hephaestin: a multicopper oxidase with ferroxidase activity.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Griffiths TA, Mauk AG, MacGillivray RT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16274220",
"url": "https://glygen.org/publication/PubMed/16274220"
}
]
},
{
"title": "A cell-surface receptor for lipocalin 24p3 selectively mediates apoptosis and iron uptake.",
"journal": "Cell",
"date": "2005",
"authors": "Devireddy LR, Gazin C, Zhu X, Green MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16377569",
"url": "https://glygen.org/publication/PubMed/16377569"
}
]
},
{
"title": "Crystal structure of human iron regulatory protein 1 as cytosolic aconitase.",
"journal": "Structure (London, England : 1993)",
"date": "2006",
"authors": "Dupuy J, Volbeda A, Carpentier P, Darnault C, Moulis JM, Fontecilla-Camps JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16407072",
"url": "https://glygen.org/publication/PubMed/16407072"
}
]
},
{
"title": "A PDZ-binding motif as a critical determinant of Rho guanine exchange factor function and cell phenotype.",
"journal": "Molecular biology of the cell",
"date": "2006",
"authors": "Liu M, Horowitz A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16467373",
"url": "https://glygen.org/publication/PubMed/16467373"
}
]
},
{
"title": "Duodenal cytochrome b: a novel ferrireductase in airway epithelial cells.",
"journal": "American journal of physiology. Lung cellular and molecular physiology",
"date": "2006",
"authors": "Turi JL, Wang X, McKie AT, Nozik-Grayck E, Mamo LB, Crissman K, Piantadosi CA, Ghio AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16510471",
"url": "https://glygen.org/publication/PubMed/16510471"
}
]
},
{
"title": "The human orthologue of CdGAP is a phosphoprotein and a GTPase-activating protein for Cdc42 and Rac1 but not RhoA.",
"journal": "Biology of the cell",
"date": "2006",
"authors": "Tcherkezian J, Triki I, Stenne R, Danek EI, Lamarche-Vane N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16519628",
"url": "https://glygen.org/publication/PubMed/16519628"
}
]
},
{
"title": "Identification of STAT3 as a specific substrate of breast tumor kinase.",
"journal": "Oncogene",
"date": "2006",
"authors": "Liu L, Gao Y, Qiu H, Miller WT, Poli V, Reich NC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "16568091",
"url": "https://glygen.org/publication/PubMed/16568091"
}
]
},
{
"title": "The diaphanous-related formin DAAM1 collaborates with the Rho GTPases RhoA and Cdc42, CIP4 and Src in regulating cell morphogenesis and actin dynamics.",
"journal": "Experimental cell research",
"date": "2006",
"authors": "Aspenstrom P, Richnau N, Johansson AS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16630611",
"url": "https://glygen.org/publication/PubMed/16630611"
}
]
},
{
"title": "Inactivation of Rho GTPases by p190 RhoGAP reduces human pancreatic cancer cell invasion and metastasis.",
"journal": "Cancer science",
"date": "2006",
"authors": "Kusama T, Mukai M, Endo H, Ishikawa O, Tatsuta M, Nakamura H, Inoue M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16776779",
"url": "https://glygen.org/publication/PubMed/16776779"
}
]
},
{
"title": "The effect of missense mutations in the RhoGAP-homology domain on ocrl1 function.",
"journal": "Molecular genetics and metabolism",
"date": "2006",
"authors": "Lichter-Konecki U, Farber LW, Cronin JS, Suchy SF, Nussbaum RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16777452",
"url": "https://glygen.org/publication/PubMed/16777452"
}
]
},
{
"title": "Physical and functional interaction of Fyn tyrosine kinase with a brain-enriched Rho GTPase-activating protein TCGAP.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Liu H, Nakazawa T, Tezuka T, Yamamoto T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16777849",
"url": "https://glygen.org/publication/PubMed/16777849"
}
]
},
{
"title": "FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling.",
"journal": "Nature cell biology",
"date": "2006",
"authors": "Ohta Y, Hartwig JH, Stossel TP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16862148",
"url": "https://glygen.org/publication/PubMed/16862148"
}
]
},
{
"title": "Gef10--the third member of a Rho-specific guanine nucleotide exchange factor subfamily with unusual protein architecture.",
"journal": "Naunyn-Schmiedeberg's archives of pharmacology",
"date": "2006",
"authors": "Mohl M, Winkler S, Wieland T, Lutz S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16896804",
"url": "https://glygen.org/publication/PubMed/16896804"
}
]
},
{
"title": "Gene targeting of Cdc42 and Cdc42GAP affirms the critical involvement of Cdc42 in filopodia induction, directed migration, and proliferation in primary mouse embryonic fibroblasts.",
"journal": "Molecular biology of the cell",
"date": "2006",
"authors": "Yang L, Wang L, Zheng Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "16914516",
"url": "https://glygen.org/publication/PubMed/16914516"
}
]
},
{
"title": "ARAP2 effects on the actin cytoskeleton are dependent on Arf6-specific GTPase-activating-protein activity and binding to RhoA-GTP.",
"journal": "Journal of cell science",
"date": "2006",
"authors": "Yoon HY, Miura K, Cuthbert EJ, Davis KK, Ahvazi B, Casanova JE, Randazzo PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "17077126",
"url": "https://glygen.org/publication/PubMed/17077126"
}
]
},
{
"title": "Carbon monoxide signals via inhibition of cytochrome c oxidase and generation of mitochondrial reactive oxygen species.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2007",
"authors": "Zuckerbraun BS, Chin BY, Bilban M, d'Avila JC, Rao J, Billiar TR, Otterbein LE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "17264172",
"url": "https://glygen.org/publication/PubMed/17264172"
}
]
},
{
"title": "Role of phospholipase Cgamma1 in cell spreading requires association with a beta-Pix/GIT1-containing complex, leading to activation of Cdc42 and Rac1.",
"journal": "Molecular and cellular biology",
"date": "2007",
"authors": "Jones NP, Katan M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "17562871",
"url": "https://glygen.org/publication/PubMed/17562871"
}
]
},
{
"title": "Regulation of ephexin1, a guanine nucleotide exchange factor of Rho family GTPases, by fibroblast growth factor receptor-mediated tyrosine phosphorylation.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Zhang Y, Sawada T, Jing X, Yokote H, Yan X, Sakaguchi K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "17702745",
"url": "https://glygen.org/publication/PubMed/17702745"
}
]
},
{
"title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.",
"journal": "Developmental cell",
"date": "2007",
"authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "17765681",
"url": "https://glygen.org/publication/PubMed/17765681"
}
]
},
{
"title": "ARHGAP4 is a novel RhoGAP that mediates inhibition of cell motility and axon outgrowth.",
"journal": "Molecular and cellular neurosciences",
"date": "2007",
"authors": "Vogt DL, Gray CD, Young WS 3rd, Orellana SA, Malouf AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "17804252",
"url": "https://glygen.org/publication/PubMed/17804252"
}
]
},
{
"title": "DLC-1 suppresses non-small cell lung cancer growth and invasion by RhoGAP-dependent and independent mechanisms.",
"journal": "Molecular carcinogenesis",
"date": "2008",
"authors": "Healy KD, Hodgson L, Kim TY, Shutes A, Maddileti S, Juliano RL, Hahn KM, Harden TK, Bang YJ, Der CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "17932950",
"url": "https://glygen.org/publication/PubMed/17932950"
}
]
},
{
"title": "Trio's Rho-specific GEF domain is the missing Galpha q effector in C. elegans.",
"journal": "Genes & development",
"date": "2007",
"authors": "Williams SL, Lutz S, Charlie NK, Vettel C, Ailion M, Coco C, Tesmer JJ, Jorgensen EM, Wieland T, Miller KG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "17942708",
"url": "https://glygen.org/publication/PubMed/17942708"
}
]
},
{
"title": "Comparison of apo- and heme-bound crystal structures of a truncated human heme oxygenase-2.",
"journal": "J. Biol. Chem.",
"date": "2007",
"authors": "Bianchetti CM, Yi L, Ragsdale SW, Phillips GN Jr",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"reference": [
{
"type": "PubMed",
"id": "17965015",
"url": "https://glygen.org/publication/PubMed/17965015"
}
]
},
{
"title": "START-GAP3/DLC3 is a GAP for RhoA and Cdc42 and is localized in focal adhesions regulating cell morphology.",
"journal": "Biochemical and biophysical research communications",
"date": "2007",
"authors": "Kawai K, Kiyota M, Seike J, Deki Y, Yagisawa H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "17976533",
"url": "https://glygen.org/publication/PubMed/17976533"
}
]
},
{
"title": "Anillin is a scaffold protein that links RhoA, actin, and myosin during cytokinesis.",
"journal": "Current biology : CB",
"date": "2008",
"authors": "Piekny AJ, Glotzer M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "18158243",
"url": "https://glygen.org/publication/PubMed/18158243"
}
]
},
{
"title": "Functional characterization of human duodenal cytochrome b (Cybrd1): Redox properties in relation to iron and ascorbate metabolism.",
"journal": "Biochimica et biophysica acta",
"date": "2008",
"authors": "Oakhill JS, Marritt SJ, Gareta EG, Cammack R, McKie AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "18194661",
"url": "https://glygen.org/publication/PubMed/18194661"
}
]
},
{
"title": "Biochemical characterization of the Rho GTPase-regulated actin assembly by diaphanous-related formins, mDia1 and Daam1, in platelets.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Higashi T, Ikeda T, Shirakawa R, Kondo H, Kawato M, Horiguchi M, Okuda T, Okawa K, Fukai S, Nureki O, Kita T, Horiuchi H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "18218625",
"url": "https://glygen.org/publication/PubMed/18218625"
}
]
},
{
"title": "Specificity of interactions between mDia isoforms and Rho proteins.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Lammers M, Meyer S, Kuhlmann D, Wittinghofer A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "18829452",
"url": "https://glygen.org/publication/PubMed/18829452"
}
]
},
{
"title": "A regulated RNA binding protein also possesses aconitase activity.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1991",
"authors": "Kaptain S, Downey WE, Tang C, Philpott C, Haile D, Orloff DG, Harford JB, Rouault TA, Klausner RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "1946430",
"url": "https://glygen.org/publication/PubMed/1946430"
}
]
},
{
"title": "Cdc42GAP, reactive oxygen species, and the vimentin network.",
"journal": "American journal of physiology. Cell physiology",
"date": "2009",
"authors": "Li QF, Spinelli AM, Tang DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "19494238",
"url": "https://glygen.org/publication/PubMed/19494238"
}
]
},
{
"title": "The rho-guanine nucleotide exchange factor domain of obscurin activates rhoA signaling in skeletal muscle.",
"journal": "Molecular biology of the cell",
"date": "2009",
"authors": "Ford-Speelman DL, Roche JA, Bowman AL, Bloch RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "19605563",
"url": "https://glygen.org/publication/PubMed/19605563"
}
]
},
{
"title": "Regulation of mitotic spindle formation by the RhoA guanine nucleotide exchange factor ARHGEF10.",
"journal": "BMC cell biology",
"date": "2009",
"authors": "Aoki T, Ueda S, Kataoka T, Satoh T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "19635168",
"url": "https://glygen.org/publication/PubMed/19635168"
}
]
},
{
"title": "Regulation of the substrate preference of p190RhoGAP by protein kinase C-mediated phosphorylation of a phospholipid binding site.",
"journal": "Biochemistry",
"date": "2009",
"authors": "Levay M, Settleman J, Ligeti E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "19673492",
"url": "https://glygen.org/publication/PubMed/19673492"
}
]
},
{
"title": "Limited role for the bilirubin-biliverdin redox amplification cycle in the cellular antioxidant protection by biliverdin reductase.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Maghzal GJ, Leck MC, Collinson E, Li C, Stocker R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "19690164",
"url": "https://glygen.org/publication/PubMed/19690164"
}
]
},
{
"title": "Regulation of immature dendritic cell migration by RhoA guanine nucleotide exchange factor Arhgef5.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Wang Z, Kumamoto Y, Wang P, Gan X, Lehmann D, Smrcka AV, Cohn L, Iwasaki A, Li L, Wu D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "19713215",
"url": "https://glygen.org/publication/PubMed/19713215"
}
]
},
{
"title": "Control of iron homeostasis by an iron-regulated ubiquitin ligase.",
"journal": "Science (New York, N.Y.)",
"date": "2009",
"authors": "Vashisht AA, Zumbrennen KB, Huang X, Powers DN, Durazo A, Sun D, Bhaskaran N, Persson A, Uhlen M, Sangfelt O, Spruck C, Leibold EA, Wohlschlegel JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "19762596",
"url": "https://glygen.org/publication/PubMed/19762596"
}
]
},
{
"title": "An E3 ligase possessing an iron-responsive hemerythrin domain is a regulator of iron homeostasis.",
"journal": "Science (New York, N.Y.)",
"date": "2009",
"authors": "Salahudeen AA, Thompson JW, Ruiz JC, Ma HW, Kinch LN, Li Q, Grishin NV, Bruick RK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "19762597",
"url": "https://glygen.org/publication/PubMed/19762597"
}
]
},
{
"title": "Biopreservation of red blood cells--the struggle with hemoglobin oxidation.",
"journal": "The FEBS journal",
"date": "2010",
"authors": "Kanias T, Acker JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "19968714",
"url": "https://glygen.org/publication/PubMed/19968714"
}
]
},
{
"title": "[PI3-kinase mediates activity of RhoA and interaction of RhoA with mDia1 in thrombin-induced platelet aggregation].",
"journal": "Zhongguo shi yan xue ye xue za zhi",
"date": "2009",
"authors": "Gao GX, Dong HJ, Gu HT, Gao Y, Pan YZ, Yang Y, Chen XQ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "20030946",
"url": "https://glygen.org/publication/PubMed/20030946"
}
]
},
{
"title": "Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.",
"journal": "Oncogene",
"date": "2010",
"authors": "Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "20101212",
"url": "https://glygen.org/publication/PubMed/20101212"
}
]
},
{
"title": "Regulation of Rho GTPase crosstalk, degradation and activity by RhoGDI1.",
"journal": "Nature cell biology",
"date": "2010",
"authors": "Boulter E, Garcia-Mata R, Guilluy C, Dubash A, Rossi G, Brennwald PJ, Burridge K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "20400958",
"url": "https://glygen.org/publication/PubMed/20400958"
}
]
},
{
"title": "A mammalian siderophore synthesized by an enzyme with a bacterial homolog involved in enterobactin production.",
"journal": "Cell",
"date": "2010",
"authors": "Devireddy LR, Hart DO, Goetz DH, Green MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "20550936",
"url": "https://glygen.org/publication/PubMed/20550936"
}
]
},
{
"title": "RhoA and DIAPH1 mediate adrenocorticotropin-stimulated cortisol biosynthesis by regulating mitochondrial trafficking.",
"journal": "Endocrinology",
"date": "2010",
"authors": "Li D, Sewer MB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "20591975",
"url": "https://glygen.org/publication/PubMed/20591975"
}
]
},
{
"title": "Gankyrin plays an essential role in Ras-induced tumorigenesis through regulation of the RhoA/ROCK pathway in mammalian cells.",
"journal": "The Journal of clinical investigation",
"date": "2010",
"authors": "Man JH, Liang B, Gu YX, Zhou T, Li AL, Li T, Jin BF, Bai B, Zhang HY, Zhang WN, Li WH, Gong WL, Li HY, Zhang XM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "20628200",
"url": "https://glygen.org/publication/PubMed/20628200"
}
]
},
{
"title": "Rho and anillin-dependent control of mDia2 localization and function in cytokinesis.",
"journal": "Molecular biology of the cell",
"date": "2010",
"authors": "Watanabe S, Okawa K, Miki T, Sakamoto S, Morinaga T, Segawa K, Arakawa T, Kinoshita M, Ishizaki T, Narumiya S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "20660154",
"url": "https://glygen.org/publication/PubMed/20660154"
}
]
},
{
"title": "Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Ikeda O, Sekine Y, Mizushima A, Nakasuji M, Miyasaka Y, Yamamoto C, Muromoto R, Nanbo A, Oritani K, Yoshimura A, Matsuda T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "20929863",
"url": "https://glygen.org/publication/PubMed/20929863"
}
]
},
{
"title": "Bi-modal regulation of a formin by srGAP2.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Mason FM, Heimsath EG, Higgs HN, Soderling SH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "21148482",
"url": "https://glygen.org/publication/PubMed/21148482"
}
]
},
{
"title": "Mutational analysis reveals a single binding interface between RhoA and its effector, PRK1.",
"journal": "Biochemistry",
"date": "2011",
"authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "21351730",
"url": "https://glygen.org/publication/PubMed/21351730"
}
]
},
{
"title": "Mechanistic insights into specificity, activity, and regulatory elements of the regulator of G-protein signaling (RGS)-containing Rho-specific guanine nucleotide exchange factors (GEFs) p115, PDZ-RhoGEF (PRG), and leukemia-associated RhoGEF (LARG).",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Jaiswal M, Gremer L, Dvorsky R, Haeusler LC, Cirstea IC, Uhlenbrock K, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "21454492",
"url": "https://glygen.org/publication/PubMed/21454492"
}
]
},
{
"title": "Detection of multiple forms of human ceruloplasmin. A novel Mr 200,000 form.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Sato M, Schilsky ML, Stockert RJ, Morell AG, Sternlieb I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "2154449",
"url": "https://glygen.org/publication/PubMed/2154449"
}
]
},
{
"title": "ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion.",
"journal": "Biochemical and biophysical research communications",
"date": "2011",
"authors": "Naji L, Pacholsky D, Aspenstrom P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "21565175",
"url": "https://glygen.org/publication/PubMed/21565175"
}
]
},
{
"title": "Enhancement of mDia2 activity by Rho-kinase-dependent phosphorylation of the diaphanous autoregulatory domain.",
"journal": "The Biochemical journal",
"date": "2011",
"authors": "Staus DP, Taylor JM, Mack CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "21699497",
"url": "https://glygen.org/publication/PubMed/21699497"
}
]
},
{
"title": "ARHGAP18, a GTPase-activating protein for RhoA, controls cell shape, spreading, and motility.",
"journal": "Molecular biology of the cell",
"date": "2011",
"authors": "Maeda M, Hasegawa H, Hyodo T, Ito S, Asano E, Yuang H, Funasaka K, Shimokata K, Hasegawa Y, Hamaguchi M, Senga T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "21865595",
"url": "https://glygen.org/publication/PubMed/21865595"
}
]
},
{
"title": "The hematopoietic cell-specific Rho GTPase inhibitor ARHGDIB/D4GDI limits HIV type 1 replication.",
"journal": "AIDS research and human retroviruses",
"date": "2012",
"authors": "Watanabe T, Urano E, Miyauchi K, Ichikawa R, Hamatake M, Misawa N, Sato K, Ebina H, Koyanagi Y, Komano J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "21936715",
"url": "https://glygen.org/publication/PubMed/21936715"
}
]
},
{
"title": "ARHGAP25, a novel Rac GTPase-activating protein, regulates phagocytosis in human neutrophilic granulocytes.",
"journal": "Blood",
"date": "2012",
"authors": "Csepanyi-Komi R, Sirokmany G, Geiszt M, Ligeti E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "22096251",
"url": "https://glygen.org/publication/PubMed/22096251"
}
]
},
{
"title": "Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome by interrupting conjugated bilirubin reuptake into the liver.",
"journal": "The Journal of clinical investigation",
"date": "2012",
"authors": "van de Steeg E, Stranecky V, Hartmannova H, Noskova L, Hrebicek M, Wagenaar E, van Esch A, de Waart DR, Oude Elferink RP, Kenworthy KE, Sticova E, al-Edreesi M, Knisely AS, Kmoch S, Jirsa M, Schinkel AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "22232210",
"url": "https://glygen.org/publication/PubMed/22232210"
}
]
},
{
"title": "The GRAF family member oligophrenin1 is a RhoGAP with BAR domain and regulates Rho GTPases in platelets.",
"journal": "Cardiovascular research",
"date": "2012",
"authors": "Elvers M, Beck S, Fotinos A, Ziegler M, Gawaz M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "22298643",
"url": "https://glygen.org/publication/PubMed/22298643"
}
]
},
{
"title": "Myosin-IXA regulates collective epithelial cell migration by targeting RhoGAP activity to cell-cell junctions.",
"journal": "Current biology : CB",
"date": "2012",
"authors": "Omelchenko T, Hall A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "22305756",
"url": "https://glygen.org/publication/PubMed/22305756"
}
]
},
{
"title": "Carbon monoxide promotes respiratory hemoproteins iron reduction using peroxides as electron donors.",
"journal": "PloS one",
"date": "2012",
"authors": "Sher EA, Shaklai M, Shaklai N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "22427940",
"url": "https://glygen.org/publication/PubMed/22427940"
}
]
},
{
"title": "Divergence of Rho residue 43 impacts GEF activity.",
"journal": "Small GTPases",
"date": "2012",
"authors": "Sloan CM, Quinn CV, Peters JP, Farley J, Goetzinger C, Wernli M, DeMali KA, Ellerbroek SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "22673745",
"url": "https://glygen.org/publication/PubMed/22673745"
}
]
},
{
"title": "Molecular modeling to provide insight into the substrate binding and catalytic mechanism of human biliverdin-IXalpha reductase.",
"journal": "The journal of physical chemistry. B",
"date": "2012",
"authors": "Fu G, Liu H, Doerksen RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "22823425",
"url": "https://glygen.org/publication/PubMed/22823425"
}
]
},
{
"title": "Identification of a novel actin-binding domain within the Rho guanine nucleotide exchange factor TEM4.",
"journal": "PloS one",
"date": "2012",
"authors": "Mitin N, Rossman KL, Der CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "22911862",
"url": "https://glygen.org/publication/PubMed/22911862"
}
]
},
{
"title": "Rho isoform-specific interaction with IQGAP1 promotes breast cancer cell proliferation and migration.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Casteel DE, Turner S, Schwappacher R, Rangaswami H, Su-Yuo J, Zhuang S, Boss GR, Pilz RB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "22992742",
"url": "https://glygen.org/publication/PubMed/22992742"
}
]
},
{
"title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.",
"journal": "Journal of proteome research",
"date": "2013",
"authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
},
{
"database": "iPTMnet",
"id": "P30519",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30519"
}
],
"reference": [
{
"type": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
}
]
},
{
"title": "ARHGAP21 is a RhoGAP for RhoA and RhoC with a role in proliferation and migration of prostate adenocarcinoma cells.",
"journal": "Biochimica et biophysica acta",
"date": "2013",
"authors": "Lazarini M, Traina F, Machado-Neto JA, Barcellos KS, Moreira YB, Brandao MM, Verjovski-Almeida S, Ridley AJ, Saad ST",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "23200924",
"url": "https://glygen.org/publication/PubMed/23200924"
}
]
},
{
"title": "Deciphering the molecular and functional basis of Dbl family proteins: a novel systematic approach toward classification of selective activation of the Rho family proteins.",
"journal": "The Journal of biological chemistry",
"date": "2013",
"authors": "Jaiswal M, Dvorsky R, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "23255595",
"url": "https://glygen.org/publication/PubMed/23255595"
}
]
},
{
"title": "ARHGDIA: a novel gene implicated in nephrotic syndrome.",
"journal": "Journal of medical genetics",
"date": "2013",
"authors": "Gupta IR, Baldwin C, Auguste D, Ha KC, El Andalousi J, Fahiminiya S, Bitzan M, Bernard C, Akbari MR, Narod SA, Rosenblatt DS, Majewski J, Takano T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "23434736",
"url": "https://glygen.org/publication/PubMed/23434736"
}
]
},
{
"title": "Plekhg4 is a novel Dbl family guanine nucleotide exchange factor protein for rho family GTPases.",
"journal": "The Journal of biological chemistry",
"date": "2013",
"authors": "Gupta M, Kamynina E, Morley S, Chung S, Muakkassa N, Wang H, Brathwaite S, Sharma G, Manor D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "23572525",
"url": "https://glygen.org/publication/PubMed/23572525"
}
]
},
{
"title": "Crucial function of vertebrate glutaredoxin 3 (PICOT) in iron homeostasis and hemoglobin maturation.",
"journal": "Molecular biology of the cell",
"date": "2013",
"authors": "Haunhorst P, Hanschmann EM, Brautigam L, Stehling O, Hoffmann B, Muhlenhoff U, Lill R, Berndt C, Lillig CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "23615448",
"url": "https://glygen.org/publication/PubMed/23615448"
}
]
},
{
"title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.",
"journal": "Journal of leukocyte biology",
"date": "2013",
"authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6798695",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695"
}
],
"reference": [
{
"type": "PubMed",
"id": "23650620",
"url": "https://glygen.org/publication/PubMed/23650620"
}
]
},
{
"title": "Vaccinia virus F11 promotes viral spread by acting as a PDZ-containing scaffolding protein to bind myosin-9A and inhibit RhoA signaling.",
"journal": "Cell host & microbe",
"date": "2013",
"authors": "Handa Y, Durkin CH, Dodding MP, Way M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "23870313",
"url": "https://glygen.org/publication/PubMed/23870313"
}
]
},
{
"title": "The human minor histocompatibility antigen 1 is a RhoGAP.",
"journal": "PloS one",
"date": "2013",
"authors": "de Kreuk BJ, Schaefer A, Anthony EC, Tol S, Fernandez-Borja M, Geerts D, Pool J, Hambach L, Goulmy E, Hordijk PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "24086303",
"url": "https://glygen.org/publication/PubMed/24086303"
}
]
},
{
"title": "Differential binding of RhoA, RhoB, and RhoC to protein kinase C-related kinase (PRK) isoforms PRK1, PRK2, and PRK3: PRKs have the highest affinity for RhoB.",
"journal": "Biochemistry",
"date": "2013",
"authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "24128008",
"url": "https://glygen.org/publication/PubMed/24128008"
}
]
},
{
"title": "The RhoGAP ARHGAP19 controls cytokinesis and chromosome segregation in T lymphocytes.",
"journal": "Journal of cell science",
"date": "2014",
"authors": "David MD, Petit D, Bertoglio J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "24259668",
"url": "https://glygen.org/publication/PubMed/24259668"
}
]
},
{
"title": "The smooth muscle-selective RhoGAP GRAF3 is a critical regulator of vascular tone and hypertension.",
"journal": "Nature communications",
"date": "2013",
"authors": "Bai X, Lenhart KC, Bird KE, Suen AA, Rojas M, Kakoki M, Li F, Smithies O, Mack CP, Taylor JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "24335996",
"url": "https://glygen.org/publication/PubMed/24335996"
}
]
},
{
"title": "Rho-GTPase-activating protein interacting with Cdc-42-interacting protein 4 homolog 2 (Rich2): a new Ras-related C3 botulinum toxin substrate 1 (Rac1) GTPase-activating protein that controls dendritic spine morphogenesis.",
"journal": "The Journal of biological chemistry",
"date": "2014",
"authors": "Raynaud F, Moutin E, Schmidt S, Dahl J, Bertaso F, Boeckers TM, Homburger V, Fagni L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "24352656",
"url": "https://glygen.org/publication/PubMed/24352656"
}
]
},
{
"title": "ARHGAP22 localizes at endosomes and regulates actin cytoskeleton.",
"journal": "PloS one",
"date": "2014",
"authors": "Mori M, Saito K, Ohta Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "24933155",
"url": "https://glygen.org/publication/PubMed/24933155"
}
]
},
{
"title": "Arhgap28 is a RhoGAP that inactivates RhoA and downregulates stress fibers.",
"journal": "PloS one",
"date": "2014",
"authors": "Yeung CY, Taylor SH, Garva R, Holmes DF, Zeef LA, Soininen R, Boot-Handford RP, Kadler KE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "25211221",
"url": "https://glygen.org/publication/PubMed/25211221"
}
]
},
{
"title": "Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.",
"journal": "Experimental cell research",
"date": "2015",
"authors": "Wu D, Zhu X, Jimenez-Cowell K, Mold AJ, Sollecito CC, Lombana N, Jiao M, Wei Q",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "25704760",
"url": "https://glygen.org/publication/PubMed/25704760"
}
]
},
{
"title": "Annexin A2 Regulates Autophagy in Pseudomonas aeruginosa Infection through the Akt1-mTOR-ULK1/2 Signaling Pathway.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2015",
"authors": "Li R, Tan S, Yu M, Jundt MC, Zhang S, Wu M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "26371245",
"url": "https://glygen.org/publication/PubMed/26371245"
}
]
},
{
"title": "Myo9b is a key player in SLIT/ROBO-mediated lung tumor suppression.",
"journal": "The Journal of clinical investigation",
"date": "2015",
"authors": "Kong R, Yi F, Wen P, Liu J, Chen X, Ren J, Li X, Shang Y, Nie Y, Wu K, Fan D, Zhu L, Feng W, Wu JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "26529257",
"url": "https://glygen.org/publication/PubMed/26529257"
}
]
},
{
"title": "Differential Rac1 signalling by guanine nucleotide exchange factors implicates FLII in regulating Rac1-driven cell migration.",
"journal": "Nature communications",
"date": "2016",
"authors": "Marei H, Carpy A, Woroniuk A, Vennin C, White G, Timpson P, Macek B, Malliri A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "26887924",
"url": "https://glygen.org/publication/PubMed/26887924"
}
]
},
{
"title": "ARHGEF15 overexpression worsens the prognosis in patients with pancreatic ductal adenocarcinoma through enhancing the motility and proliferative activity of the cancer cells.",
"journal": "Molecular cancer",
"date": "2016",
"authors": "Fukushima H, Yasumoto M, Ogasawara S, Akiba J, Kitasato Y, Nakayama M, Naito Y, Ishida Y, Okabe Y, Yasunaga M, Horiuchi H, Sakamoto E, Itadani H, Mizuarai S, Oie S, Yano H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "27145964",
"url": "https://glygen.org/publication/PubMed/27145964"
}
]
},
{
"title": "Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-Activating Proteins in Basal-like Breast Cancers.",
"journal": "Cancer research",
"date": "2016",
"authors": "Lawson CD, Fan C, Mitin N, Baker NM, George SD, Graham DM, Perou CM, Burridge K, Der CJ, Rossman KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "27216196",
"url": "https://glygen.org/publication/PubMed/27216196"
}
]
},
{
"title": "Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.",
"journal": "The Journal of biological chemistry",
"date": "2016",
"authors": "Amin E, Jaiswal M, Derewenda U, Reis K, Nouri K, Koessmeier KT, Aspenstrom P, Somlyo AV, Dvorsky R, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "27481945",
"url": "https://glygen.org/publication/PubMed/27481945"
}
]
},
{
"title": "SOS1, ARHGEF1, and DOCK2 rho-GEFs Mediate JAK-Dependent LFA-1 Activation by Chemokines.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2017",
"authors": "Toffali L, Montresor A, Mirenda M, Scita G, Laudanna C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "27986909",
"url": "https://glygen.org/publication/PubMed/27986909"
}
]
},
{
"title": "Blood pressure-associated polymorphism controls ARHGAP42 expression via serum response factor DNA binding.",
"journal": "The Journal of clinical investigation",
"date": "2017",
"authors": "Bai X, Mangum KD, Dee RA, Stouffer GA, Lee CR, Oni-Orisan A, Patterson C, Schisler JC, Viera AJ, Taylor JM, Mack CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "28112683",
"url": "https://glygen.org/publication/PubMed/28112683"
}
]
},
{
"title": "Characterization of the activation of small GTPases by their GEFs on membranes using artificial membrane tethering.",
"journal": "The Biochemical journal",
"date": "2017",
"authors": "Peurois F, Veyron S, Ferrandez Y, Ladid I, Benabdi S, Zeghouf M, Peyroche G, Cherfils J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "28196833",
"url": "https://glygen.org/publication/PubMed/28196833"
}
]
},
{
"title": "ARHGAP42 is activated by Src-mediated tyrosine phosphorylation to promote cell motility.",
"journal": "Journal of cell science",
"date": "2017",
"authors": "Luo W, Janostiak R, Tolde O, Ryzhova LM, Koudelkova L, Dibus M, Brabek J, Hanks SK, Rosel D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "28584191",
"url": "https://glygen.org/publication/PubMed/28584191"
}
]
},
{
"title": "Crystal structure of CO-bound cytochrome c oxidase determined by serial femtosecond X-ray crystallography at room temperature.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2017",
"authors": "Ishigami I, Zatsepin NA, Hikita M, Conrad CE, Nelson G, Coe JD, Basu S, Grant TD, Seaberg MH, Sierra RG, Hunter MS, Fromme P, Fromme R, Yeh SR, Rousseau DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "28698372",
"url": "https://glygen.org/publication/PubMed/28698372"
}
]
},
{
"title": "Cytokinesis requires localized beta-actin filament production by an actin isoform specific nucleator.",
"journal": "Nature communications",
"date": "2017",
"authors": "Chen A, Arora PD, McCulloch CA, Wilde A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "29146911",
"url": "https://glygen.org/publication/PubMed/29146911"
}
]
},
{
"title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2018",
"authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P30519",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P30519"
},
{
"database": "O-GlcNAc Atlas",
"id": "P30519",
"url": "https://oglcnac.org/atlas/detail/P30519"
}
],
"reference": [
{
"type": "PubMed",
"id": "29351928",
"url": "https://glygen.org/publication/PubMed/29351928"
}
]
},
{
"title": "Anillin Promotes Cell Contractility by Cyclic Resetting of RhoA Residence Kinetics.",
"journal": "Developmental cell",
"date": "2019",
"authors": "Budnar S, Husain KB, Gomez GA, Naghibosadat M, Varma A, Verma S, Hamilton NA, Morris RG, Yap AS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "31105010",
"url": "https://glygen.org/publication/PubMed/31105010"
}
]
},
{
"title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.",
"journal": "Nature cell biology",
"date": "2020",
"authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "31871319",
"url": "https://glygen.org/publication/PubMed/31871319"
}
]
},
{
"title": "Systems analysis of RhoGEF and RhoGAP regulatory proteins reveals spatially organized RAC1 signalling from integrin adhesions.",
"journal": "Nature cell biology",
"date": "2020",
"authors": "Muller PM, Rademacher J, Bagshaw RD, Wortmann C, Barth C, van Unen J, Alp KM, Giudice G, Eccles RL, Heinrich LE, Pascual-Vargas P, Sanchez-Castro M, Brandenburg L, Mbamalu G, Tucholska M, Spatt L, Czajkowski MT, Welke RW, Zhang S, Nguyen V, Rrustemi T, Trnka P, Freitag K, Larsen B, Popp O, Mertins P, Gingras AC, Roth FP, Colwill K, Bakal C, Pertz O, Pawson T, Petsalaki E, Rocks O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "32203420",
"url": "https://glygen.org/publication/PubMed/32203420"
}
]
},
{
"title": "Heme oxygenase-2 is post-translationally regulated by heme occupancy in the catalytic site.",
"journal": "The Journal of biological chemistry",
"date": "2020",
"authors": "Liu L, Dumbrepatil AB, Fleischhacker AS, Marsh ENG, Ragsdale SW",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
},
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
}
],
"reference": [
{
"type": "PubMed",
"id": "33051205",
"url": "https://glygen.org/publication/PubMed/33051205"
}
]
},
{
"title": "Immune Modulation by Inhibitors of the HO System.",
"journal": "International journal of molecular sciences",
"date": "2020",
"authors": "Fernandez-Fierro A, Funes SC, Rios M, Covian C, Gonzalez J, Kalergis AM",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
},
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
}
],
"reference": [
{
"type": "PubMed",
"id": "33396647",
"url": "https://glygen.org/publication/PubMed/33396647"
}
]
},
{
"title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.",
"journal": "Biochimica et biophysica acta. General subjects",
"date": "2021",
"authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P30519",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P30519"
}
],
"reference": [
{
"type": "PubMed",
"id": "34019948",
"url": "https://glygen.org/publication/PubMed/34019948"
}
]
},
{
"title": "Synthesis of Na2S2O4 mediated cleavable affinity tag for labeling of O-GlcNAc modified proteins via azide-alkyne cycloaddition.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2021",
"authors": "Wang J, Dou B, Zheng L, Cao W, Zeng X, Wen Y, Ma J, Li X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P30519",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P30519"
}
],
"reference": [
{
"type": "PubMed",
"id": "34229054",
"url": "https://glygen.org/publication/PubMed/34229054"
}
]
},
{
"title": "Carbon monoxide binding to human hemoglobin A0.",
"journal": "Biochemistry",
"date": "1987",
"authors": "Di Cera E, Doyle ML, Connelly PR, Gill SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "3427020",
"url": "https://glygen.org/publication/PubMed/3427020"
}
]
},
{
"title": "Antioxidant activity of albumin-bound bilirubin.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1987",
"authors": "Stocker R, Glazer AN, Ames BN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "3475708",
"url": "https://glygen.org/publication/PubMed/3475708"
}
]
},
{
"title": "Heme oxygenase-2 (HO-2) binds and buffers labile ferric heme in human embryonic kidney cells.",
"journal": "The Journal of biological chemistry",
"date": "2022",
"authors": "Hanna DA, Moore CM, Liu L, Yuan X, Dominic IM, Fleischhacker AS, Hamza I, Ragsdale SW, Reddi AR",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
},
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
}
],
"reference": [
{
"type": "PubMed",
"id": "34973332",
"url": "https://glygen.org/publication/PubMed/34973332"
}
]
},
{
"title": "Heme oxygenase-1 & 2 and their potential contribution in heme induced colorectal carcinogenesis.",
"journal": "Pathology, research and practice",
"date": "2022",
"authors": "Gamage SMK, Nanayakkara S, Macfarlane L, Hewage D, Cheng T, Aktar S, Lu CT, Dissabandara L, Islam F, Lam AK, Gopalan V",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001120676",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120676"
},
{
"database": "RefSeq",
"id": "NP_001273196",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273196"
}
],
"reference": [
{
"type": "PubMed",
"id": "35428017",
"url": "https://glygen.org/publication/PubMed/35428017"
}
]
},
{
"title": "Two hepatic cytoplasmic protein fractions, Y and Z, and their possible role in the hepatic uptake of bilirubin, sulfobromophthalein, and other anions.",
"journal": "The Journal of clinical investigation",
"date": "1969",
"authors": "Levi AJ, Gatmaitan Z, Arias IM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "4980931",
"url": "https://glygen.org/publication/PubMed/4980931"
}
]
},
{
"title": "Hemoglobin. A biologic fenton reagent.",
"journal": "The Journal of biological chemistry",
"date": "1984",
"authors": "Sadrzadeh SM, Graf E, Panter SS, Hallaway PE, Eaton JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "6094553",
"url": "https://glygen.org/publication/PubMed/6094553"
}
]
},
{
"title": "Bilirubin binding to human liver ligandin (glutathione S-transferase).",
"journal": "The Journal of biological chemistry",
"date": "1980",
"authors": "Simons PC, Jagt DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "7372607",
"url": "https://glygen.org/publication/PubMed/7372607"
}
]
},
{
"title": "Abr and Bcr are multifunctional regulators of the Rho GTP-binding protein family.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Chuang TH, Xu X, Kaartinen V, Heisterkamp N, Groffen J, Bokoch GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "7479768",
"url": "https://glygen.org/publication/PubMed/7479768"
}
]
},
{
"title": "Bridging Ral GTPase to Rho pathways. RLIP76, a Ral effector with CDC42/Rac GTPase-activating protein activity.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Jullien-Flores V, Dorseuil O, Romero F, Letourneur F, Saragosti S, Berger R, Tavitian A, Gacon G, Camonis JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "7673236",
"url": "https://glygen.org/publication/PubMed/7673236"
}
]
},
{
"title": "Direct involvement of the small GTP-binding protein Rho in lbc oncogene function.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Zheng Y, Olson MF, Hall A, Cerione RA, Toksoz D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "7721814",
"url": "https://glygen.org/publication/PubMed/7721814"
}
]
},
{
"title": "A role for Rac in Tiam1-induced membrane ruffling and invasion.",
"journal": "Nature",
"date": "1995",
"authors": "Michiels F, Habets GG, Stam JC, van der Kammen RA, Collard JG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "7753201",
"url": "https://glygen.org/publication/PubMed/7753201"
}
]
},
{
"title": "Heme oxygenase-2. Properties of the heme complex of the purified tryptic fragment of recombinant human heme oxygenase-2.",
"journal": "J. Biol. Chem.",
"date": "1995",
"authors": "Ishikawa K, Takeuchi N, Takahashi S, Matera KM, Sato M, Shibahara S, Rousseau DL, Ikeda-Saito M, Yoshida T",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"reference": [
{
"type": "PubMed",
"id": "7890772",
"url": "https://glygen.org/publication/PubMed/7890772"
}
]
},
{
"title": "Molecular characterization of a second iron-responsive element binding protein, iron regulatory protein 2. Structure, function, and post-translational regulation.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Samaniego F, Chin J, Iwai K, Rouault TA, Klausner RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "7983023",
"url": "https://glygen.org/publication/PubMed/7983023"
}
]
},
{
"title": "Breakpoint cluster region gene product-related domain of n-chimaerin. Discrimination between Rac-binding and GTPase-activating residues by mutational analysis.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Ahmed S, Lee J, Wen LP, Zhao Z, Ho J, Best A, Kozma R, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8021274",
"url": "https://glygen.org/publication/PubMed/8021274"
}
]
},
{
"title": "The bifunctional iron-responsive element binding protein/cytosolic aconitase: the role of active-site residues in ligand binding and regulation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1994",
"authors": "Philpott CC, Klausner RD, Rouault TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "8041788",
"url": "https://glygen.org/publication/PubMed/8041788"
}
]
},
{
"title": "p190-B, a new member of the Rho GAP family, and Rho are induced to cluster after integrin cross-linking.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Burbelo PD, Miyamoto S, Utani A, Brill S, Yamada KM, Hall A, Yamada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8537347",
"url": "https://glygen.org/publication/PubMed/8537347"
}
]
},
{
"title": "A novel partner for the GTP-bound forms of rho and rac.",
"journal": "FEBS letters",
"date": "1995",
"authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8543060",
"url": "https://glygen.org/publication/PubMed/8543060"
}
]
},
{
"title": "Protein kinase N (PKN) and PKN-related protein rhophilin as targets of small GTPase Rho.",
"journal": "Science (New York, N.Y.)",
"date": "1996",
"authors": "Watanabe G, Saito Y, Madaule P, Ishizaki T, Fujisawa K, Morii N, Mukai H, Ono Y, Kakizuka A, Narumiya S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8571126",
"url": "https://glygen.org/publication/PubMed/8571126"
}
]
},
{
"title": "The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.",
"journal": "The EMBO journal",
"date": "1996",
"authors": "Ishizaki T, Maekawa M, Fujisawa K, Okawa K, Iwamatsu A, Fujita A, Watanabe N, Saito Y, Kakizuka A, Morii N, Narumiya S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8617235",
"url": "https://glygen.org/publication/PubMed/8617235"
}
]
},
{
"title": "The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1996",
"authors": "Debant A, Serra-Pages C, Seipel K, O'Brien S, Tang M, Park SH, Streuli M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8643598",
"url": "https://glygen.org/publication/PubMed/8643598"
}
]
},
{
"title": "An SH3 domain-containing GTPase-activating protein for Rho and Cdc42 associates with focal adhesion kinase.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Hildebrand JD, Taylor JM, Parsons JT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8649427",
"url": "https://glygen.org/publication/PubMed/8649427"
}
]
},
{
"title": "Rhotekin, a new putative target for Rho bearing homology to a serine/threonine kinase, PKN, and rhophilin in the rho-binding domain.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Reid T, Furuyashiki T, Ishizaki T, Watanabe G, Watanabe N, Fujisawa K, Morii N, Madaule P, Narumiya S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8662891",
"url": "https://glygen.org/publication/PubMed/8662891"
}
]
},
{
"title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1996",
"authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6798695",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695"
}
],
"reference": [
{
"type": "PubMed",
"id": "8692836",
"url": "https://glygen.org/publication/PubMed/8692836"
}
]
},
{
"title": "The ferritins: molecular properties, iron storage function and cellular regulation.",
"journal": "Biochimica et biophysica acta",
"date": "1996",
"authors": "Harrison PM, Arosio P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "8695634",
"url": "https://glygen.org/publication/PubMed/8695634"
}
]
},
{
"title": "The Ras GTPase-activating-protein-related human protein IQGAP2 harbors a potential actin binding domain and interacts with calmodulin and Rho family GTPases.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Brill S, Li S, Lyman CW, Church DM, Wasmuth JJ, Weissbach L, Bernards A, Snijders AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8756646",
"url": "https://glygen.org/publication/PubMed/8756646"
}
]
},
{
"title": "Interaction of the Rho family small G proteins with kinectin, an anchoring protein of kinesin motor.",
"journal": "Biochemical and biophysical research communications",
"date": "1996",
"authors": "Hotta K, Tanaka K, Mino A, Kohno H, Takai Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8769096",
"url": "https://glygen.org/publication/PubMed/8769096"
}
]
},
{
"title": "Rho proteins are localized with different membrane compartments involved in vesicular trafficking in anterior pituitary cells.",
"journal": "Molecular and cellular endocrinology",
"date": "1996",
"authors": "Cussac D, Leblanc P, L'Heritier A, Bertoglio J, Lang P, Kordon C, Enjalbert A, Saltarelli D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8807639",
"url": "https://glygen.org/publication/PubMed/8807639"
}
]
},
{
"title": "Identification of a novel guanine nucleotide exchange factor for the Rho GTPase.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Hart MJ, Sharma S, elMasry N, Qiu RG, McCabe P, Polakis P, Bollag G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8810315",
"url": "https://glygen.org/publication/PubMed/8810315"
}
]
},
{
"title": "The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Leung T, Chen XQ, Manser E, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8816443",
"url": "https://glygen.org/publication/PubMed/8816443"
}
]
},
{
"title": "RhoGDI-3 is a new GDP dissociation inhibitor (GDI). Identification of a non-cytosolic GDI protein interacting with the small GTP-binding proteins RhoB and RhoG.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Zalcman G, Closson V, Camonis J, Honore N, Rousseau-Merck MF, Tavitian A, Olofsson B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "8939998",
"url": "https://glygen.org/publication/PubMed/8939998"
}
]
},
{
"title": "Characterization of two alternately spliced forms of phospholipase D1. Activation of the purified enzymes by phosphatidylinositol 4,5-bisphosphate, ADP-ribosylation factor, and Rho family monomeric GTP-binding proteins and protein kinase C-alpha.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Hammond SM, Jenco JM, Nakashima S, Cadwallader K, Gu Q, Cook S, Nozawa Y, Prestwich GD, Frohman MA, Morris AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9013646",
"url": "https://glygen.org/publication/PubMed/9013646"
}
]
},
{
"title": "Cloning, expression, and characterization of a novel phospholipase D complementary DNA from rat brain.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Kodaki T, Yamashita S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9111050",
"url": "https://glygen.org/publication/PubMed/9111050"
}
]
},
{
"title": "RhoGDIgamma: a GDP-dissociation inhibitor for Rho proteins with preferential expression in brain and pancreas.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997",
"authors": "Adra CN, Manor D, Ko JL, Zhu S, Horiuchi T, Van Aelst L, Cerione RA, Lim B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9113980",
"url": "https://glygen.org/publication/PubMed/9113980"
}
]
},
{
"title": "A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Saras J, Franzen P, Aspenstrom P, Hellman U, Gonez LJ, Heldin CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9305890",
"url": "https://glygen.org/publication/PubMed/9305890"
}
]
},
{
"title": "Myotonic dystrophy kinase-related Cdc42-binding kinase acts as a Cdc42 effector in promoting cytoskeletal reorganization.",
"journal": "Molecular and cellular biology",
"date": "1998",
"authors": "Leung T, Chen XQ, Tan I, Manser E, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9418861",
"url": "https://glygen.org/publication/PubMed/9418861"
}
]
},
{
"title": "Human myosin-IXb is a mechanochemically active motor and a GAP for rho.",
"journal": "Journal of cell science",
"date": "1998",
"authors": "Post PL, Bokoch GM, Mooseker MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9490638",
"url": "https://glygen.org/publication/PubMed/9490638"
}
]
},
{
"title": "MgcRacGAP, a new human GTPase-activating protein for Rac and Cdc42 similar to Drosophila rotundRacGAP gene product, is expressed in male germ cells.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Toure A, Dorseuil O, Morin L, Timmons P, Jegou B, Reibel L, Gacon G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9497316",
"url": "https://glygen.org/publication/PubMed/9497316"
}
]
},
{
"title": "Analysis of RhoA-binding proteins reveals an interaction domain conserved in heterotrimeric G protein beta subunits and the yeast response regulator protein Skn7.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Alberts AS, Bouquin N, Johnston LH, Treisman R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9535835",
"url": "https://glygen.org/publication/PubMed/9535835"
}
]
},
{
"title": "Regulation of RhoA GTP hydrolysis by the GTPase-activating proteins p190, p50RhoGAP, Bcr, and 3BP-1.",
"journal": "Biochemistry",
"date": "1998",
"authors": "Zhang B, Zheng Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9548756",
"url": "https://glygen.org/publication/PubMed/9548756"
}
]
},
{
"title": "PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.",
"journal": "Molecular cell",
"date": "1998",
"authors": "Manser E, Loo TH, Koh CG, Zhao ZS, Chen XQ, Tan L, Tan I, Leung T, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9659915",
"url": "https://glygen.org/publication/PubMed/9659915"
}
]
},
{
"title": "Activation of RhoA and SAPK/JNK signalling pathways by the RhoA-specific exchange factor mNET1.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Alberts AS, Treisman R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9670022",
"url": "https://glygen.org/publication/PubMed/9670022"
}
]
},
{
"title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9792683",
"url": "https://glygen.org/publication/PubMed/9792683"
}
]
},
{
"title": "Phosphorylation-dependent and constitutive activation of Rho proteins by wild-type and oncogenic Vav-2.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Schuebel KE, Movilla N, Rosa JL, Bustelo XR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9822605",
"url": "https://glygen.org/publication/PubMed/9822605"
}
]
},
{
"title": "Dimerization via tandem leucine zippers is essential for the activation of the mitogen-activated protein kinase kinase kinase, MLK-3.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Leung IW, Lassam N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8980692",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692"
}
],
"reference": [
{
"type": "PubMed",
"id": "9829970",
"url": "https://glygen.org/publication/PubMed/9829970"
}
]
}
],
"pathway": [
{
"id": "hsa:3163",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3163",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-189483",
"name": "Heme degradation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483",
"resource": "Reactome",
"description": "Heme degradation"
},
{
"id": "R-HSA-6798695",
"name": "Neutrophil degranulation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695",
"resource": "Reactome",
"description": "Neutrophil degranulation"
},
{
"id": "R-HSA-8980692",
"name": "RHOA GTPase cycle",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692",
"resource": "Reactome",
"description": "RHOA GTPase cycle"
},
{
"id": "R-HSA-917937",
"name": "Iron uptake and transport",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937",
"resource": "Reactome",
"description": "Iron uptake and transport"
},
{
"id": "R-HSA-9707564",
"name": "Cytoprotection by HMOX1",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564",
"resource": "Reactome",
"description": "Cytoprotection by HMOX1"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "O70252-1",
"protein_name": "Heme oxygenase 2",
"gene_name": "Hmox2",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MSSEVETSEGVDESEKNSMAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKAALIKDMKYFFGENWEEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFEHVDNAQQFKQFYRARMNALDLNLKTKERIVEEANKAFEYNMQIFSELDQAGSMLARETLEDGLPVHDGKGDIRKCPFYAAQPDKGTLGGSNCPFQTTVAVLRKPSLQLILAASVALVAGLLAWYYM",
"length": 315
},
"evidence": [
{
"id": "45237083",
"url": "http://www.informatics.jax.org/homology/45237083",
"database": "MGI"
},
{
"id": "P30519",
"url": "https://omabrowser.org/oma/group/P30519/",
"database": "OMA"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "P23711-1",
"protein_name": "Heme oxygenase 2",
"gene_name": "Hmox2",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MSSEVETSEGVDESENNSTAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKEALIKDMEYFFGENWEEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFEHVDNAQQFKQFYRARMNALDLSMKTKERIVEEANKAFEYNMQIFSELDQAGSMLTKETLEDGLPVHDGKGDVRKCPFYAAQPDKGTLGGSNCPFRTAMAVLRKPSLQLILAASVALVAGLLAWYYM",
"length": 315
},
"evidence": [
{
"id": "45237083",
"url": "http://www.informatics.jax.org/homology/45237083",
"database": "MGI"
},
{
"id": "P30519",
"url": "https://omabrowser.org/oma/group/P30519/",
"database": "OMA"
}
],
"common_name": "Rat"
}
],
"go_annotation": {
"categories": [
{
"name": "Cellular Component",
"total": 4,
"go_terms": [
{
"name": "membrane",
"id": "GO:0016020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
},
{
"name": "plasma membrane",
"id": "GO:0005886",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
},
{
"name": "specific granule membrane",
"id": "GO:0035579",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035579",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
},
{
"name": "endoplasmic reticulum membrane",
"id": "GO:0005789",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 3,
"go_terms": [
{
"name": "metal ion binding",
"id": "GO:0046872",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
},
{
"name": "heme oxygenase (decyclizing) activity",
"id": "GO:0004392",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004392",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
},
{
"name": "heme binding",
"id": "GO:0020037",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 4,
"go_terms": [
{
"name": "heme oxidation",
"id": "GO:0006788",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006788",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
},
{
"name": "response to oxidative stress",
"id": "GO:0006979",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
},
{
"name": "response to hypoxia",
"id": "GO:0001666",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
},
{
"name": "heme catabolic process",
"id": "GO:0042167",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042167",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [],
"ptm_annotation": [
{
"annotation": "A soluble form arises by proteolytic removal of the membrane anchor.",
"evidence": [
{
"database": "UniProtKB",
"id": "P30519",
"url": "https://www.uniprot.org/uniprot/P30519"
},
{
"database": "PubMed",
"id": "7890772",
"url": "https://glygen.org/publication/PubMed/7890772"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "21764",
"name": "",
"equation": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P06762-1",
"O70453-1",
"P23711-1",
"P09601-1",
"P30519-1",
"O70252-1",
"P14901-1",
"Q9VGJ9-1"
],
"evidence": [
{
"id": "21764",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/21764"
}
]
},
{
"id": "R-HSA-189398",
"name": "HMOX1 dimer, HMOX2 cleave heme",
"equation": "",
"summary": "Heme oxygenases (HMOXs) cleaves the heme ring at the alpha-methene bridge to form bilverdin. This reaction forms the only endogenous source of carbon monoxide. HMOX1 is inducible and is thought to have an antioxidant role as it is activated in virtually all cell types and by many types of \\oxidative stress\\ (Poss & Tonegawa 1997). HMOX1 forms dimers/oligomers in the endoplasmatic reticulum. This oligomerization is crucial for the stabilization and function of HMOX1 in the ER (Hwang et al. 2009). HMOX2 is non-inducible.",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-189385"
],
"enzyme_list": [
"P09601-1",
"P30519-1"
],
"evidence": [
{
"id": "R-HSA-189398",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189398"
}
]
},
{
"id": "R-HSA-6799350",
"name": "Exocytosis of specific granule membrane proteins",
"equation": "",
"summary": "Secondary (specific) granules are peroxidase-negative and rich in antimicrobial substances (Joiner et al. 1989, Rorvig et al. 2012). They are more irregular and elongated in form than azurophil granules (Bainton et al. 1971). This may reflect volume adjustment in azurophil granules, which are known to proteolytically process a significant fraction of the proteins that are targeted to them, while little or no processing and therefore no increase in osmotic activity due to proteolysis has been observed in secondary granules (Borregaard & Cowland 1997). Secondary and tertiary granules have overlapping contents but can be discriminated by their intrinsic buoyant densities when centrifuged on gradient media (Kjeldsen et al. 1994).",
"cellular_location": "plasma membrane, specific granule membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q13393-1",
"P61225-1",
"O15120-1",
"Q9NPA2-1",
"P62834-1",
"P00749-1",
"O14672-1",
"P78325-1",
"P43353-1",
"Q8TF62-1",
"P98196-1",
"Q9Y2Q0-1",
"Q12913-1",
"Q13303-1",
"O15121-1",
"O75907-1",
"O14975-1",
"Q5T4S7-1",
"Q10588-1",
"P04839-1",
"Q68CP4-1",
"P23467-1",
"P30519-1",
"O94804-1"
],
"evidence": [
{
"id": "R-HSA-6799350",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799350"
}
]
},
{
"id": "R-HSA-9013009",
"name": "RHOA binds effectors at the plasma membrane",
"equation": "",
"summary": "In its GTP bound active form, plasma membrane associated RHOA (or constitutively active RHOA mutant in the high throughput study by Bagci et al. 2020) binds to the following effectors:
ANLN (Piekny and Glotzer 2008; Budnar et al. 2019; Bagci et al. 2020)
CIT (Madaule et al. 1995; Bagci et al. 2020) and its neuron specific splicing isoform CIT 3 (Di Cunto et al. 1998)
DAAM1 (Aspenstrom et al. 2006; Higashi et al. 2008)
DIAPH1 (Otomo et al. 2005; Higashi et al. 2008; Lammers et al. 2008; Gao et al. 2009; Li and Sewer 2010; Bagci et al. 2020)
DIAPH3 (Alberts et al. 1998; Watanabe et al. 2010; Staus et al. 2011; Chen et al. 2017; Bagci et al. 2020)
IQGAP1 (Casteel et al. 2012)
PKN1 (Maesaki et al. 1999; Hutchinson et al. 2011; Hutchinson et al. 2013)
PKN2 (Hutchinson et al. 2013; Bagci et al. 2020)
PKN3 (Hutchinson et al. 2013)
PLD1 (Hammond et al. 1997; Yamazaki et al. 1999)
RHPN1 (Watanabe et al. 1996; Peck et al. 2002)
RHPN2 (Peck et al. 2002)
ROCK1 (Ishizaki et al. 1996; Leung et al. 1996; Bagci et al. 2020)
ROCK2 (Leung et al. 1996; Bagci et al. 2020)
RTKN (Reid et al. 1996; Fu et al. 2000)
SLK (Bagci et al. 2020: interaction and activation of SLK downstream of RHOA confirmed in detail)
STK10 (Bagci et al. 2020: interaction corroborated by additional experimental methods)
The following putative RHOA effectors are annotated as candidates either because of opposing findings reported by different studies or because their binding to RHOA was only shown in the context of constitutively active RHOA mutant in the high throughput screen by Bagci et al. 2020:
AAAS (Bagci et al. 2020)
ABCD3 (Bagci et al. 2020)
ACBD5 (Bagci et al. 2020)
ACTC1 (Bagci et al. 2020)
ARHGAP1 (Bagci et al. 2020)
BCR (Bagci et al. 2020)
C1QBP (Bagci et al. 2020)
CAV1 (Bagci et al. 2020)
CAVIN1 (Bagci et al. 2020)
DEPDC1B (Bagci et al. 2020)
ERBIN (Bagci et al. 2020)
FAF2 (Bagci et al. 2020)
FLOT1 (Bagci et al. 2020)
FLOT2 (Bagci et al. 2020)
FMNL3 (Bagci et al. 2020: binding to RHOA; Vega et al. 2011: no binding to RHOA)
HMOX2 (Bagci et al. 2020)
IQGAP3 (Bagci et al. 2020)
JUP (Bagci et al. 2020)
MCAM (Bagci et al. 2020)
MYO9B (Bagci et al. 2020)
PCDH7 (Bagci et al. 2020)
SCFD1 (Bagci et al. 2020)
SNAP23 (Bagci et al. 2020)
SOWAHC (Bagci et al. 2020)
STBD1 (Bagci et al. 2020)
STOM (Bagci et al. 2020)
TFRC (Bagci et al. 2020)
TJP2 (Bagci et al. 2020)
TMPO (Bagci et al. 2020)
VAMP3 (Bagci et al. 2020)
VANGL1 (Bagci et al. 2020)
RHOA does not bind the following effectors:
CCDC187 (Bagci et al. 2020)
CDC42BPA (Leung et al. 1998)
CDC42BPB (Leung et al. 1998)
CDC42EP1 (Joberty et al. 1999)
CDC42EP2 (Joberty et al. 1999)
CDC42EP3 (Joberty et al. 1999)
CDC42EP4 (Joberty et al. 1999)
CDC42EP5 (Joberty et al. 1999)
FMNL2 (Kitzing et al. 2010)
IQGAP2 (Brill et al. 1996)
KIAA0355 (Bagci et al. 2020)
PLD2 (Kodaki and Yamashita 1997)
WAS (WASP) (Aspenstrom et al. 1996)",
"cellular_location": "plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q13393-1",
"Q13464-1",
"O14578-1",
"O75116-1",
"P28288-1",
"P68032-1",
"Q16512-1",
"P61586-1",
"Q6P5Z2-1",
"Q9H2G2-1",
"P30519-1",
"Q16513-1",
"O94804-1"
],
"evidence": [
{
"id": "R-HSA-9013009",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013009"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-189385",
"participant_name": "CO [cytosol]",
"crossref": [
{
"id": "C00237",
"database": "COMPOUND",
"url": ""
},
{
"id": "17245",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001361",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "9531",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00237",
"database": "COMPOUND",
"url": ""
},
{
"id": "17245",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001361",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "9531",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00237",
"database": "COMPOUND",
"url": ""
},
{
"id": "17245",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001361",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "9531",
"database": "Guide to Pharmacology - Ligands",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "O14578",
"gene_name": "CIT",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O14578",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14578"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O14578",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14578"
}
]
}
]
},
{
"uniprot_ac": "O14672",
"gene_name": "ADAM10",
"activity": [
{
"ec_number": "3.4.24.81",
"activity": "Endopeptidase of broad specificity.",
"evidence": [
{
"id": "O14672",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14672"
}
]
},
{
"ec_number": "3.4.24.81",
"activity": "",
"evidence": [
{
"id": "O14672",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14672"
}
]
}
]
},
{
"uniprot_ac": "O14975",
"gene_name": "SLC27A2",
"activity": [
{
"ec_number": "6.2.1.3",
"activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.",
"evidence": [
{
"id": "O14975",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14975"
}
]
},
{
"ec_number": "6.2.1.-",
"activity": "",
"evidence": [
{
"id": "O14975",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14975"
}
]
},
{
"ec_number": "6.2.1.7",
"activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.",
"evidence": [
{
"id": "O14975",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14975"
}
]
},
{
"ec_number": "6.2.1.24",
"activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.",
"evidence": [
{
"id": "O14975",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14975"
}
]
},
{
"ec_number": "6.2.1.15",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.",
"evidence": [
{
"id": "O14975",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14975"
}
]
}
]
},
{
"uniprot_ac": "O15120",
"gene_name": "AGPAT2",
"activity": [
{
"ec_number": "2.3.1.51",
"activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.",
"evidence": [
{
"id": "O15120",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15120"
}
]
},
{
"ec_number": "2.3.1.51",
"activity": "",
"evidence": [
{
"id": "O15120",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15120"
}
]
}
]
},
{
"uniprot_ac": "O15121",
"gene_name": "DEGS1",
"activity": [
{
"ec_number": "1.14.19.17",
"activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.",
"evidence": [
{
"id": "O15121",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15121"
}
]
},
{
"ec_number": "5.2.1.-",
"activity": "",
"evidence": [
{
"id": "O15121",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15121"
}
]
},
{
"ec_number": "1.14.19.17",
"activity": "",
"evidence": [
{
"id": "O15121",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15121"
}
]
}
]
},
{
"uniprot_ac": "O70252",
"gene_name": "Hmox2",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "O70252",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70252"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "O70252",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70252"
}
]
}
]
},
{
"uniprot_ac": "O70453",
"gene_name": "Hmox3",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "O70453",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70453"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "O70453",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70453"
}
]
}
]
},
{
"uniprot_ac": "O75116",
"gene_name": "ROCK2",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O75116",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75116"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O75116",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75116"
}
]
}
]
},
{
"uniprot_ac": "O75907",
"gene_name": "DGAT1",
"activity": [
{
"ec_number": "2.3.1.20",
"activity": "a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA.",
"evidence": [
{
"id": "O75907",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75907"
}
]
},
{
"ec_number": "2.3.1.76",
"activity": "all-trans-retinol + an acyl-CoA = an all-trans-retinyl ester + CoA.",
"evidence": [
{
"id": "O75907",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75907"
}
]
},
{
"ec_number": "2.3.1.20",
"activity": "",
"evidence": [
{
"id": "O75907",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75907"
}
]
}
]
},
{
"uniprot_ac": "O94804",
"gene_name": "STK10",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O94804",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94804"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O94804",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94804"
}
]
}
]
},
{
"uniprot_ac": "P00749",
"gene_name": "PLAU",
"activity": [
{
"ec_number": "3.4.21.73",
"activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.",
"evidence": [
{
"id": "P00749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00749"
}
]
},
{
"ec_number": "3.4.21.73",
"activity": "",
"evidence": [
{
"id": "P00749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00749"
}
]
}
]
},
{
"uniprot_ac": "P04839",
"gene_name": "CYBB",
"activity": [
{
"ec_number": "1.-.-.-",
"activity": "",
"evidence": [
{
"id": "P04839",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04839"
}
]
}
]
},
{
"uniprot_ac": "P06762",
"gene_name": "Hmox1",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P06762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06762"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P06762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06762"
}
]
}
]
},
{
"uniprot_ac": "P09601",
"gene_name": "HMOX1",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P09601",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09601"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P09601",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09601"
}
]
}
]
},
{
"uniprot_ac": "P14901",
"gene_name": "Hmox1",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P14901",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14901"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P14901",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14901"
}
]
}
]
},
{
"uniprot_ac": "P23467",
"gene_name": "PTPRB",
"activity": [
{
"ec_number": "3.1.3.48",
"activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
"evidence": [
{
"id": "P23467",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23467"
}
]
},
{
"ec_number": "3.1.3.48",
"activity": "",
"evidence": [
{
"id": "P23467",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23467"
}
]
}
]
},
{
"uniprot_ac": "P23711",
"gene_name": "Hmox2",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P23711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23711"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P23711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23711"
}
]
}
]
},
{
"uniprot_ac": "P28288",
"gene_name": "ABCD3",
"activity": [
{
"ec_number": "3.1.2.-",
"activity": "",
"evidence": [
{
"id": "P28288",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28288"
}
]
},
{
"ec_number": "7.6.2.-",
"activity": "",
"evidence": [
{
"id": "P28288",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28288"
}
]
}
]
},
{
"uniprot_ac": "P30519",
"gene_name": "HMOX2",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P30519",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30519"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P30519",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30519"
}
]
}
]
},
{
"uniprot_ac": "P43353",
"gene_name": "ALDH3B1",
"activity": [
{
"ec_number": "1.2.1.5",
"activity": "an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH.",
"evidence": [
{
"id": "P43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43353"
}
]
},
{
"ec_number": "1.2.1.28",
"activity": "benzaldehyde + H2O + NAD(+) = benzoate + 2 H(+) + NADH.",
"evidence": [
{
"id": "P43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43353"
}
]
},
{
"ec_number": "1.2.1.7",
"activity": "benzaldehyde + H2O + NADP(+) = benzoate + 2 H(+) + NADPH.",
"evidence": [
{
"id": "P43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43353"
}
]
},
{
"ec_number": "1.2.1.5",
"activity": "",
"evidence": [
{
"id": "P43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43353"
}
]
},
{
"ec_number": "1.2.1.7",
"activity": "",
"evidence": [
{
"id": "P43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43353"
}
]
},
{
"ec_number": "1.2.1.28",
"activity": "",
"evidence": [
{
"id": "P43353",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43353"
}
]
}
]
},
{
"uniprot_ac": "P61225",
"gene_name": "RAP2B",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P61225",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61225"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P61225",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61225"
}
]
}
]
},
{
"uniprot_ac": "P61586",
"gene_name": "RHOA",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P61586",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61586"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P61586",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61586"
}
]
}
]
},
{
"uniprot_ac": "P62834",
"gene_name": "RAP1A",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P62834",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62834"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P62834",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62834"
}
]
}
]
},
{
"uniprot_ac": "P68032",
"gene_name": "ACTC1",
"activity": [
{
"ec_number": "3.6.4.-",
"activity": "",
"evidence": [
{
"id": "P68032",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P68032"
}
]
}
]
},
{
"uniprot_ac": "P78325",
"gene_name": "ADAM8",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "P78325",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78325"
}
]
}
]
},
{
"uniprot_ac": "P98196",
"gene_name": "ATP11A",
"activity": [
{
"ec_number": "7.6.2.1",
"activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.",
"evidence": [
{
"id": "P98196",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P98196"
}
]
},
{
"ec_number": "7.6.2.1",
"activity": "",
"evidence": [
{
"id": "P98196",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P98196"
}
]
}
]
},
{
"uniprot_ac": "Q10588",
"gene_name": "BST1",
"activity": [
{
"ec_number": "3.2.2.6",
"activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.",
"evidence": [
{
"id": "Q10588",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q10588"
}
]
},
{
"ec_number": "3.2.2.6",
"activity": "",
"evidence": [
{
"id": "Q10588",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q10588"
}
]
}
]
},
{
"uniprot_ac": "Q12913",
"gene_name": "PTPRJ",
"activity": [
{
"ec_number": "3.1.3.48",
"activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
"evidence": [
{
"id": "Q12913",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12913"
}
]
},
{
"ec_number": "3.1.3.48",
"activity": "",
"evidence": [
{
"id": "Q12913",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12913"
}
]
}
]
},
{
"uniprot_ac": "Q13303",
"gene_name": "KCNAB2",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "Q13303",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13303"
}
]
}
]
},
{
"uniprot_ac": "Q13393",
"gene_name": "PLD1",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "Q13393",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13393"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "Q13393",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13393"
}
]
}
]
},
{
"uniprot_ac": "Q13464",
"gene_name": "ROCK1",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q13464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13464"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q13464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13464"
}
]
}
]
},
{
"uniprot_ac": "Q16512",
"gene_name": "PKN1",
"activity": [
{
"ec_number": "2.7.11.13",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q16512",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16512"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "",
"evidence": [
{
"id": "Q16512",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16512"
}
]
}
]
},
{
"uniprot_ac": "Q16513",
"gene_name": "PKN2",
"activity": [
{
"ec_number": "2.7.11.13",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q16513",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16513"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "",
"evidence": [
{
"id": "Q16513",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16513"
}
]
}
]
},
{
"uniprot_ac": "Q5T4S7",
"gene_name": "UBR4",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5T4S7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T4S7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5T4S7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T4S7"
}
]
}
]
},
{
"uniprot_ac": "Q68CP4",
"gene_name": "HGSNAT",
"activity": [
{
"ec_number": "2.3.1.78",
"activity": "acetyl-CoA + alpha-D-glucosaminyl-[heparan sulfate](n) = CoA + H(+) + N-acetyl-alpha-D-glucosaminyl-[heparan sulfate](n).",
"evidence": [
{
"id": "Q68CP4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q68CP4"
}
]
},
{
"ec_number": "2.3.1.78",
"activity": "",
"evidence": [
{
"id": "Q68CP4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q68CP4"
}
]
}
]
},
{
"uniprot_ac": "Q6P5Z2",
"gene_name": "PKN3",
"activity": [
{
"ec_number": "2.7.11.13",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q6P5Z2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P5Z2"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "",
"evidence": [
{
"id": "Q6P5Z2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P5Z2"
}
]
}
]
},
{
"uniprot_ac": "Q8TF62",
"gene_name": "ATP8B4",
"activity": [
{
"ec_number": "7.6.2.1",
"activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.",
"evidence": [
{
"id": "Q8TF62",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TF62"
}
]
},
{
"ec_number": "7.6.2.1",
"activity": "",
"evidence": [
{
"id": "Q8TF62",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TF62"
}
]
}
]
},
{
"uniprot_ac": "Q9H2G2",
"gene_name": "SLK",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9H2G2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H2G2"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q9H2G2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H2G2"
}
]
}
]
},
{
"uniprot_ac": "Q9NPA2",
"gene_name": "MMP25",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "Q9NPA2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NPA2"
}
]
}
]
},
{
"uniprot_ac": "Q9VGJ9",
"gene_name": "Ho",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9VGJ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VGJ9"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "Q9VGJ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VGJ9"
}
]
}
]
},
{
"uniprot_ac": "Q9Y2Q0",
"gene_name": "ATP8A1",
"activity": [
{
"ec_number": "7.6.2.1",
"activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.",
"evidence": [
{
"id": "Q9Y2Q0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2Q0"
}
]
},
{
"ec_number": "7.6.2.1",
"activity": "",
"evidence": [
{
"id": "Q9Y2Q0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2Q0"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 2
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 2
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 216
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}