{ "uniprot_canonical_ac": "P30115-1", "uniprot_ac": "P30115", "uniprot_id": "GSTA3_MOUSE", "mass": { "chemical_mass": 25361.0, "monoisotopic_mass": 25361.0 }, "refseq": { "ac": "NP_001070821", "name": "glutathione S-transferase A3 isoform a", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821" }, "gene_names": [ { "name": "Gsta3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P30115", "id": "P30115" }, { "name": "Gst2-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821", "id": "NP_001070821" }, { "name": "Gsta3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821", "id": "NP_001070821" }, { "name": "Gstyc", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P30115", "id": "P30115" } ], "protein_names": [ { "name": "Glutathione S-transferase A3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P30115" }, { "name": "2.5.1.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P30115" }, { "name": "GST class-alpha member 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P30115" }, { "name": "Glutathione S-transferase Ya3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P30115" }, { "name": "Glutathione S-transferase Yc", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P30115" }, { "name": "glutathione S-transferase A3 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821", "id": "NP_001070821" }, { "name": "glutathione S-transferase A3; GST class-alpha member 3; glutathione S-transferase Yc; glutathione S-transferase Ya3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821", "id": "NP_001070821" } ], "function": [ { "annotation": "Aflatoxin B1 induces cholangiocarcinomas in GSTA3-/- mice", "evidence": [ { "database": "RefSeq", "id": "NP_001070821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821" }, { "database": "PubMed", "id": "29804515", "url": "https://glygen.org/publication/PubMed/29804515" } ] }, { "annotation": "Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Catalyzes isomerization reactions that contribute to the biosynthesis of steroid hormones. Efficiently catalyze obligatory double-bond isomerizations of delta(5)-androstene-3,17-dione and delta(5)-pregnene-3,20-dione, precursors to testosterone and progesterone, respectively (By similarity). Has a high catalytic activity for aflatoxin B1-8,9 epoxide (PubMed:1637297).", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115#function" }, { "database": "PubMed", "id": "1637297", "url": "https://glygen.org/publication/PubMed/1637297" }, { "database": "UniProtKB", "id": "Q16772", "url": "https://www.uniprot.org/uniprot/Q16772#function" } ] }, { "annotation": "There were no significant compensatory changes in KO mice GST subunits, GST enzymatic activity, epoxide hydrolase, or CYP1A2 and CYP3A11 levels. Finally, there was a modest increase in F2-isoprostane and isofuran in KO mice that confirmed putative GSTA3 hydroperoxidase activity in vivo for the first time.", "evidence": [ { "database": "RefSeq", "id": "NP_001070821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821" }, { "database": "PubMed", "id": "28535182", "url": "https://glygen.org/publication/PubMed/28535182" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gsta3", "url": "https://www.uniprot.org/uniprot/P30115", "locus": { "chromosome": "1", "start_pos": 21335885, "end_pos": 21310813, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000025934", "url": "https://www.ensembl.org/id/ENSMUSG00000025934" } ] } } ], "crossref": [ { "id": "ENSMUSG00000025934", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000025934", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03077", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03077", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03208", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03208", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "14859", "url": "https://www.ncbi.nlm.nih.gov/gene/14859", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P30115", "url": "https://www.ebi.ac.uk/intact/interactors/id:P30115*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003080", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003080", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004045", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004045", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004046", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004046", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010987", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010987", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036282", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036282", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:14859", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14859", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "95856", "url": "http://www.informatics.jax.org/marker/MGI:95856", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "EEYFANM", "url": "https://omabrowser.org/oma/group/EEYFANM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3412208at2759", "url": "http://www.orthodb.org/?query=3412208at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11571", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11571:SF107", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571:SF107", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00043", "url": "http://pfam.xfam.org/family/PF00043", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02798", "url": "http://pfam.xfam.org/family/PF02798", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P30115", "url": "http://purl.obolibrary.org/obo/PR_P30115", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-189483", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9748787", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001070821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16437", "url": "https://www.rhea-db.org/rhea/16437", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "43928", "url": "https://www.rhea-db.org/rhea/43928", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "43936", "url": "https://www.rhea-db.org/rhea/43936", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A087WQI6", "url": "https://www.uniprot.org/uniprot/A0A087WQI6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WQI6-1", "url": "https://www.uniprot.org/uniprot/A0A087WQI6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P30115-1", "url": "https://www.uniprot.org/uniprot/P30115-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEIDGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASLAKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFPLLKALRSRVSNLPTVKKFLQPGSQRKPFDDAKCVESAKKIFS", "length": 221, "header": "sp|P30115-1|GSTA3_MOUSE Isoform 1 of Glutathione S-transferase A3 OS=Mus musculus OX=10090 GN=Gsta3 PE=1 SV=2 CANONICAL=P30115-1" }, "isoforms": [ { "isoform_ac": "A0A087WQI6-1", "url": "", "sequence": { "sequence": "MFQQVPMVEIDGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASLAKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFPLLKA", "length": 133, "header": "tr|A0A087WQI6-1|GSTA3_MOUSE Computationally mapped isoform of Glutathione S-transferase A3 OS=Mus musculus OX=10090 GN=Gsta3 PE=1 SV=1 CANONICAL=P30115-1" }, "locus": { "chromosome": "1", "start_pos": 21335069, "end_pos": 21329083, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000124990.3", "url": "https://www.ensembl.org/id/ENSMUST00000124990.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000140210.2", "url": "https://www.ensembl.org/id/ENSMUSP00000140210.2" } ] } }, { "isoform_ac": "P30115-1", "url": "", "sequence": { "sequence": "MAGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEIDGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASLAKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFPLLKALRSRVSNLPTVKKFLQPGSQRKPFDDAKCVESAKKIFS", "length": 221, "header": "sp|P30115-1|GSTA3_MOUSE Isoform 1 of Glutathione S-transferase A3 OS=Mus musculus OX=10090 GN=Gsta3 PE=1 SV=2 CANONICAL=P30115-1" }, "locus": { "chromosome": "1", "start_pos": 21335183, "end_pos": 21319996, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000027067", "url": "https://www.ensembl.org/id/ENSMUST00000027067" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000027067", "url": "https://www.ensembl.org/id/ENSMUSP00000027067" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Molecular cloning and heterologous expression of a cDNA encoding a mouse glutathione S-transferase Yc subunit possessing high catalytic activity for aflatoxin B1-8,9-epoxide.", "journal": "Biochem. J.", "date": "1992", "authors": "Hayes JD, Judah DJ, Neal GE, Nguyen T", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "reference": [ { "type": "PubMed", "id": "1637297", "url": "https://glygen.org/publication/PubMed/1637297" } ] }, { "title": "Complementary DNA cloning, messenger RNA expression, and induction of alpha-class glutathione S-transferases in mouse tissues.", "journal": "Cancer Res.", "date": "1992", "authors": "Buetler TM, Eaton DL", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "reference": [ { "type": "PubMed", "id": "1728405", "url": "https://glygen.org/publication/PubMed/1728405" } ] }, { "title": "Regulation of mouse glutathione S-transferases by chemoprotectors. Molecular evidence for the existence of three distinct alpha-class glutathione S-transferase subunits, Ya1, Ya2, and Ya3, in mouse liver.", "journal": "Biochem. J.", "date": "1991", "authors": "Cronshaw A.D., Hayes J.D., Kerr L.A., McLellan L.I.", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "reference": [ { "type": "PubMed", "id": "2049074", "url": "https://glygen.org/publication/PubMed/2049074" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Characterization of liver injury, oval cell proliferation and cholangiocarcinogenesis in glutathione S-transferase A3 knockout mice.", "journal": "Carcinogenesis", "date": "2017", "authors": "Crawford DR, Ilic Z, Guest I, Milne GL, Hayes JD, Sell S", "evidence": [ { "database": "RefSeq", "id": "NP_001070821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821" } ], "reference": [ { "type": "PubMed", "id": "28535182", "url": "https://glygen.org/publication/PubMed/28535182" } ] }, { "title": "Participation of liver stem cells in cholangiocarcinogenesis after aflatoxin B1 exposure of glutathione S-transferase A3 knockout mice.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2018", "authors": "Ilic Z, Mondal TK, Guest I, Crawford DR, Sell S", "evidence": [ { "database": "RefSeq", "id": "NP_001070821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070821" } ], "reference": [ { "type": "PubMed", "id": "29804515", "url": "https://glygen.org/publication/PubMed/29804515" } ] }, { "title": "Purification, mass spectrometric characterization, and covalent modification of murine glutathione S-transferases.", "journal": "Chem. Res. Toxicol.", "date": "1995", "authors": "Mitchell AE, Morin D, Lame MW, Jones AD", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "reference": [ { "type": "PubMed", "id": "8605288", "url": "https://glygen.org/publication/PubMed/8605288" } ] } ], "pathway": [ { "id": "mmu:14859", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14859", "resource": "KEGG Pathway" }, { "id": "R-MMU-156590", "name": "Glutathione conjugation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "resource": "Reactome", "description": "Glutathione conjugation" }, { "id": "R-MMU-189483", "name": "Heme degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-189483", "resource": "Reactome", "description": "Heme degradation" }, { "id": "R-MMU-9748787", "name": "Azathioprine ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9748787", "resource": "Reactome", "description": "Azathioprine ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "P46418-1", "protein_name": "Glutathione S-transferase alpha-5", "gene_name": "Gsta5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS", "length": 221 }, "evidence": [ { "id": "45237592", "url": "http://www.informatics.jax.org/homology/45237592", "database": "MGI" }, { "id": "P30115", "url": "https://omabrowser.org/oma/group/P30115/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF", "length": 222 }, "evidence": [ { "id": "45237592", "url": "http://www.informatics.jax.org/homology/45237592", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q7RTV2-1", "protein_name": "Glutathione S-transferase A5", "gene_name": "GSTA5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF", "length": 222 }, "evidence": [ { "id": "45237592", "url": "http://www.informatics.jax.org/homology/45237592", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "glutathione transferase activity", "id": "GO:0004364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "aflatoxin catabolic process", "id": "GO:0046223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046223", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "pmid": "" }, { "name": "ureteric bud development", "id": "GO:0001657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001657", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "pmid": "" }, { "name": "glutathione metabolic process", "id": "GO:0006749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P30115", "url": "https://www.uniprot.org/uniprot/P30115" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16437", "name": "", "equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04904-1", "P46418-1", "P24473-1", "P30713-1", "Q6AXY0-1", "Q9QX69-1", "O35543-1", "Q9Z339-1", "P08009-1", "P14942-1", "Q9Z1B2-1", "Q6AXV9-1", "Q5BK56-1", "P00502-1", "P04903-1", "P04905-1", "P04906-1", "P57113-1", "Q01579-1", "P08010-1", "P08011-1", "Q4V8E6-1", "A0A0G2K4Q5-1", "A0A8I5ZLR0-1", "Q9Y2Q3-1", "Q9H4Y5-1", "P46439-1", "Q03013-1", "P78417-1", "P08263-1", "P0CG30-1", "P09488-1", "Q7RTV2-1", "Q16772-1", "P28161-1", "P0CG29-1", "O60760-1", "P09211-1", "P30711-1", "P09210-1", "O15217-1", "O43813-1", "P21266-1", "P10620-1", "O43708-1", "Q99735-1", "A0A1W2PR19-1", "A0A1W2PRG0-1", "F6RWR5-1", "P19157-1", "Q9JHF7-1", "E9Q6L7-1", "Q61133-1", "Q9WVL0-1", "O35660-1", "P46425-1", "P19639-1", "P48774-1", "Q9DCM2-1", "Q99L20-1", "O09131-1", "P24472-1", "Q8K2Q2-1", "Q80W21-1", "O89112-1", "P10648-1", "P13745-1", "P15626-1", "P30115-1", "P10649-1", "Q64471-1", "Q9D4P7-1", "Q91VS7-1", "Q6P8Q0-1", "A2RST1-1", "Q8R5I6-1", "P17695-1", "P25373-1", "P36156-1", "P40582-1", "P48239-1", "Q04806-1", "Q12390-1", "Q54GA9-1", "Q54QV7-1", "Q54VI4-1", "Q55FF3-1", "Q86AU1-1", "Q556G3-1", "Q9VG94-1", "Q9VG96-1", "Q7JYX0-1", "E1JJS1-1", "P41043-1", "P20432-1", "Q9VG95-1", "Q9VG98-1", "Q9VG93-1", "Q9VHD3-1", "Q9VHD2-1", "Q7K0B6-1", "Q8MRM0-1" ], "evidence": [ { "id": "16437", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16437" } ] }, { "id": "43928", "name": "", "equation": "pregn-5-ene-3,20-dione = progesterone", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22071-1", "P04904-1", "P14060-1", "P26439-1", "Q16772-1", "P24815-1", "P30115-1", "P26149-1" ], "evidence": [ { "id": "43928", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/43928" } ] }, { "id": "43936", "name": "", "equation": "androst-5-ene-3,17-dione = androst-4-ene-3,17-dione", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22071-1", "P00502-1", "P04904-1", "P14060-1", "P08263-1", "P26439-1", "Q16772-1", "P24815-1", "P13745-1", "P30115-1", "P26149-1" ], "evidence": [ { "id": "43936", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/43936" } ] }, { "id": "R-MMU-176054", "name": "GST dimers conjugate GSH with cytosolic substrates", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q61133-1", "Q8K2Q2-1", "E9Q6L7-1", "Q8R5I6-1", "P30115-1", "P13745-1", "P19157-1", "P19639-1", "Q9JHF7-1", "Q9WVL0-1", "Q6P8Q0-1", "P10649-1", "P10648-1", "O09131-1", "O35660-1", "P15626-1", "Q64471-1", "Q80W21-1", "P48774-1" ], "evidence": [ { "id": "R-MMU-176054", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-176054" } ] }, { "id": "R-MMU-9663492", "name": "BIL dissociates from GSTA1, FABP1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "E9Q6L7-1", "P30115-1", "P13745-1", "Q6P8Q0-1", "P10648-1" ], "evidence": [ { "id": "R-MMU-9663492", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9663492" } ] }, { "id": "R-MMU-9663511", "name": "BIL binds GSTA1, FABP1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "E9Q6L7-1", "P30115-1", "P13745-1", "Q6P8Q0-1", "P10648-1" ], "evidence": [ { "id": "R-MMU-9663511", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9663511" } ] }, { "id": "R-MMU-9748996", "name": "GST dimers cleave AZA to 6MP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9748994" ], "output_participant_list": [ "R-ALL-9748998", "R-ALL-9748975" ], "enzyme_list": [ "E9Q6L7-1", "P30115-1", "P13745-1", "Q6P8Q0-1", "P10648-1", "P15626-1" ], "evidence": [ { "id": "R-MMU-9748996", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9748996" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-9748975", "participant_name": "GS-nitroimidazole [cytosol]", "crossref": [ { "id": "180931", "database": "ChEBI", "url": "" }, { "id": "180931", "database": "ChEBI", "url": "" }, { "id": "180931", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9748994", "participant_name": "AZA [cytosol]", "crossref": [ { "id": "7120", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00620", "database": "PharmacoDB", "url": "" }, { "id": "PDBC00620", "database": "PharmacoDB", "url": "" }, { "id": "7120", "database": "Guide to Pharmacology", "url": "" }, { "id": "7120", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00620", "database": "PharmacoDB", "url": "" } ] }, { "participant_id": "R-ALL-9748998", "participant_name": "6MP [cytosol]", "crossref": [ { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K4Q5", "gene_name": "Gstp3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A0G2K4Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A0G2K4Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5" } ] } ] }, { "uniprot_ac": "A0A1W2PR19", "gene_name": "GSTT4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] } ] }, { "uniprot_ac": "A0A1W2PRG0", "gene_name": "", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A1W2PRG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PRG0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A1W2PRG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PRG0" } ] } ] }, { "uniprot_ac": "A0A8I5ZLR0", "gene_name": "Gstt3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A8I5ZLR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZLR0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A8I5ZLR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZLR0" } ] } ] }, { "uniprot_ac": "A2RST1", "gene_name": "Mgst2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] } ] }, { "uniprot_ac": "E1JJS1", "gene_name": "GstT3", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "E1JJS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E1JJS1" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "E1JJS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E1JJS1" } ] } ] }, { "uniprot_ac": "E9Q6L7", "gene_name": "Gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "E9Q6L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q6L7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "E9Q6L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q6L7" } ] } ] }, { "uniprot_ac": "F6RWR5", "gene_name": "Gstp3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "F6RWR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F6RWR5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F6RWR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F6RWR5" } ] } ] }, { "uniprot_ac": "O09131", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] } ] }, { "uniprot_ac": "O15217", "gene_name": "GSTA4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] } ] }, { "uniprot_ac": "O35543", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] } ] }, { "uniprot_ac": "O35660", "gene_name": "Gstm6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] } ] }, { "uniprot_ac": "O43708", "gene_name": "GSTZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] } ] }, { "uniprot_ac": "O43813", "gene_name": "LANCL1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] } ] }, { "uniprot_ac": "O60760", "gene_name": "HPGDS", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] } ] }, { "uniprot_ac": "O89112", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] } ] }, { "uniprot_ac": "P00502", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] } ] }, { "uniprot_ac": "P04903", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] } ] }, { "uniprot_ac": "P04904", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04904" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04904" } ] } ] }, { "uniprot_ac": "P04905", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] } ] }, { "uniprot_ac": "P04906", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] } ] }, { "uniprot_ac": "P08009", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] } ] }, { "uniprot_ac": "P08010", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] } ] }, { "uniprot_ac": "P08011", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] } ] }, { "uniprot_ac": "P08263", "gene_name": "GSTA1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] } ] }, { "uniprot_ac": "P09210", "gene_name": "GSTA2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] } ] }, { "uniprot_ac": "P09211", "gene_name": "GSTP1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] } ] }, { "uniprot_ac": "P09488", "gene_name": "GSTM1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] } ] }, { "uniprot_ac": "P0CG29", "gene_name": "GSTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] } ] }, { "uniprot_ac": "P0CG30", "gene_name": "GSTT2B", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] } ] }, { "uniprot_ac": "P10620", "gene_name": "MGST1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] } ] }, { "uniprot_ac": "P10648", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] } ] }, { "uniprot_ac": "P10649", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] } ] }, { "uniprot_ac": "P13745", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] } ] }, { "uniprot_ac": "P14060", "gene_name": "HSD3B1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] } ] }, { "uniprot_ac": "P14942", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] } ] }, { "uniprot_ac": "P15626", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] } ] }, { "uniprot_ac": "P17695", "gene_name": "GRX2", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] } ] }, { "uniprot_ac": "P19157", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] } ] }, { "uniprot_ac": "P19639", "gene_name": "Gstm3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] } ] }, { "uniprot_ac": "P20432", "gene_name": "GstD1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride + H(+).", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] } ] }, { "uniprot_ac": "P21266", "gene_name": "GSTM3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] } ] }, { "uniprot_ac": "P22071", "gene_name": "Hsd3b1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] } ] }, { "uniprot_ac": "P24472", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] } ] }, { "uniprot_ac": "P24473", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] } ] }, { "uniprot_ac": "P24815", "gene_name": "Hsd3b1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] } ] }, { "uniprot_ac": "P25373", "gene_name": "GRX1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] } ] }, { "uniprot_ac": "P26149", "gene_name": "Hsd3b2", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P26149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26149" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P26149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26149" } ] } ] }, { "uniprot_ac": "P26439", "gene_name": "HSD3B2", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P26439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26439" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P26439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26439" } ] } ] }, { "uniprot_ac": "P28161", "gene_name": "GSTM2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] } ] }, { "uniprot_ac": "P30115", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] } ] }, { "uniprot_ac": "P30711", "gene_name": "GSTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] } ] }, { "uniprot_ac": "P30713", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] } ] }, { "uniprot_ac": "P36156", "gene_name": "ECM4", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] } ] }, { "uniprot_ac": "P40582", "gene_name": "GTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P40582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40582" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P40582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40582" } ] } ] }, { "uniprot_ac": "P41043", "gene_name": "GstS1", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] } ] }, { "uniprot_ac": "P46418", "gene_name": "Gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46418" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46418" } ] } ] }, { "uniprot_ac": "P46425", "gene_name": "Gstp2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] } ] }, { "uniprot_ac": "P46439", "gene_name": "GSTM5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] } ] }, { "uniprot_ac": "P48239", "gene_name": "GTO1", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] } ] }, { "uniprot_ac": "P48774", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] } ] }, { "uniprot_ac": "P57113", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] } ] }, { "uniprot_ac": "P78417", "gene_name": "GSTO1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] } ] }, { "uniprot_ac": "Q01579", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] } ] }, { "uniprot_ac": "Q03013", "gene_name": "GSTM4", "activity": [ { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] } ] }, { "uniprot_ac": "Q04806", "gene_name": "GTO3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q04806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04806" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q04806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04806" } ] } ] }, { "uniprot_ac": "Q12390", "gene_name": "GTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q12390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12390" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q12390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12390" } ] } ] }, { "uniprot_ac": "Q16772", "gene_name": "GSTA3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] } ] }, { "uniprot_ac": "Q4V8E6", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] } ] }, { "uniprot_ac": "Q54GA9", "gene_name": "mgst", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GA9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GA9" } ] } ] }, { "uniprot_ac": "Q54QV7", "gene_name": "gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] } ] }, { "uniprot_ac": "Q54VI4", "gene_name": "gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] } ] }, { "uniprot_ac": "Q556G3", "gene_name": "gsta2-2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] } ] }, { "uniprot_ac": "Q55FF3", "gene_name": "gsta1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] } ] }, { "uniprot_ac": "Q5BK56", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] } ] }, { "uniprot_ac": "Q61133", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] } ] }, { "uniprot_ac": "Q64471", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] } ] }, { "uniprot_ac": "Q6AXV9", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] } ] }, { "uniprot_ac": "Q6AXY0", "gene_name": "Gsta6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] } ] }, { "uniprot_ac": "Q6P8Q0", "gene_name": "Gm3776", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] } ] }, { "uniprot_ac": "Q7JYX0", "gene_name": "GstE14", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] } ] }, { "uniprot_ac": "Q7K0B6", "gene_name": "GstT1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q7K0B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K0B6" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7K0B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K0B6" } ] } ] }, { "uniprot_ac": "Q7RTV2", "gene_name": "GSTA5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] } ] }, { "uniprot_ac": "Q80W21", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] } ] }, { "uniprot_ac": "Q86AU1", "gene_name": "gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] } ] }, { "uniprot_ac": "Q8K2Q2", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] } ] }, { "uniprot_ac": "Q8MRM0", "gene_name": "GstT4", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q8MRM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MRM0" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8MRM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MRM0" } ] } ] }, { "uniprot_ac": "Q8R5I6", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] } ] }, { "uniprot_ac": "Q91VS7", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] } ] }, { "uniprot_ac": "Q99735", "gene_name": "MGST2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] } ] }, { "uniprot_ac": "Q99L20", "gene_name": "Gstt3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] } ] }, { "uniprot_ac": "Q9D4P7", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] } ] }, { "uniprot_ac": "Q9DCM2", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] } ] }, { "uniprot_ac": "Q9H4Y5", "gene_name": "GSTO2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] } ] }, { "uniprot_ac": "Q9JHF7", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] } ] }, { "uniprot_ac": "Q9QX69", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] } ] }, { "uniprot_ac": "Q9VG93", "gene_name": "GstD7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] } ] }, { "uniprot_ac": "Q9VG94", "gene_name": "GstD6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] } ] }, { "uniprot_ac": "Q9VG95", "gene_name": "GstD5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] } ] }, { "uniprot_ac": "Q9VG96", "gene_name": "GstD4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] } ] }, { "uniprot_ac": "Q9VG98", "gene_name": "GstD2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] } ] }, { "uniprot_ac": "Q9VHD2", "gene_name": "GstZ2", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] } ] }, { "uniprot_ac": "Q9VHD3", "gene_name": "GstZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] } ] }, { "uniprot_ac": "Q9WVL0", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] } ] }, { "uniprot_ac": "Q9Y2Q3", "gene_name": "GSTK1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] } ] }, { "uniprot_ac": "Q9Z1B2", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] } ] }, { "uniprot_ac": "Q9Z339", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }