{ "uniprot_canonical_ac": "P29401-1", "uniprot_ac": "P29401", "uniprot_id": "TKT_HUMAN", "mass": { "chemical_mass": 67878.0, "monoisotopic_mass": 67878.0 }, "refseq": { "ac": "NP_001055", "name": "transketolase isoform 1", "summary": "This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" }, "gene_names": [ { "name": "TKT", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P29401", "id": "P29401" }, { "name": "HEL-S-48; HEL107; SDDHD; TK; TKT1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055", "id": "NP_001055" }, { "name": "TKT", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055", "id": "NP_001055" } ], "protein_names": [ { "name": "Transketolase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P29401" }, { "name": "2.2.1.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P29401" }, { "name": "TK", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P29401" }, { "name": "epididymis luminal protein 107; epididymis secretory protein Li 48", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055", "id": "NP_001055" }, { "name": "transketolase isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055", "id": "NP_001055" } ], "function": [ { "annotation": "Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate.", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401#function" }, { "database": "PubMed", "id": "27259054", "url": "https://glygen.org/publication/PubMed/27259054" } ] }, { "annotation": "QM/MM Study of Human Transketolase: Thiamine Diphosphate Activation Mechanism and Complete Catalytic Cycle.", "evidence": [ { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" }, { "database": "PubMed", "id": "34161071", "url": "https://glygen.org/publication/PubMed/34161071" } ] }, { "annotation": "The crystal structure of human transketolase and new insights into its mode of action.", "evidence": [ { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" }, { "database": "PubMed", "id": "20667822", "url": "https://glygen.org/publication/PubMed/20667822" } ] }, { "annotation": "This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" } ] }, { "annotation": "Transketolase promotes colorectal cancer metastasis through regulating AKT phosphorylation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" }, { "database": "PubMed", "id": "35110545", "url": "https://glygen.org/publication/PubMed/35110545" } ] }, { "annotation": "Untargeted metabolomics as an unbiased approach to the diagnosis of inborn errors of metabolism of the non-oxidative branch of the pentose phosphate pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" }, { "database": "PubMed", "id": "32828637", "url": "https://glygen.org/publication/PubMed/32828637" } ] } ], "disease": [ { "disease_id": "MONDO:0014881", "recommended_name": { "id": "MONDO:0014881", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014881", "name": "transketolase deficiency", "description": "" }, "synonyms": [ { "id": "MONDO:0014881", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014881", "name": "TKT deficiency", "description": "" }, { "id": "MONDO:0014881", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014881", "name": "short stature-developmental delay-congenital heart defect syndrome", "description": "" }, { "id": "MONDO:0014881", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014881", "name": "SDDHD", "description": "" }, { "id": "MONDO:0014881", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014881", "name": "short stature, developmental delay, and congenital heart defects", "description": "" }, { "id": "MIM:617044", "resource": "MIM", "url": "https://www.omim.org/entry/617044", "name": "Short stature, developmental delay, and congenital heart defects", "description": "Short stature, developmental delay, and congenital heart defects" } ], "evidence": [ { "id": "617044", "database": "MIM", "url": "https://www.omim.org/entry/617044" } ] } ], "snv": [ { "evidence": [ { "id": "P29401", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P29401" }, { "id": "rs1553679757", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553679757" }, { "id": "rs1553679757", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553679757" }, { "id": "rs1553679757", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1553679757" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 102, "end_pos": 102, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KIS->NIS).", "chr_id": "3", "chr_pos": "53241165", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K102", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1553677063", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553677063" }, { "id": "rs1553677063", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1553677063" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 267, "end_pos": 267, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NMA->NMT).", "chr_id": "3", "chr_pos": "53231500", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A267", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P29401", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P29401" } ], "glycoeffect": [], "start_pos": 404, "end_pos": 404, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "53229334", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A404", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs782597830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782597830" }, { "id": "rs782597830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782597830" }, { "id": "rs782597830", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782597830#frequency_tab" }, { "id": "rs782597830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782597830" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 411, "end_pos": 411, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIN->NIS).", "chr_id": "3", "chr_pos": "53229312", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N411", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1165534124", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1165534124" }, { "id": "rs1165534124", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1165534124#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 484, "end_pos": 484, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNN->NNS).", "chr_id": "3", "chr_pos": "53228304", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N484", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781989562", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781989562" }, { "id": "rs781989562", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781989562" }, { "id": "rs781989562", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781989562" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 583, "end_pos": 583, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TVT->NVT).", "chr_id": "3", "chr_pos": "53225880", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T583", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "91.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "95.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "88.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "94.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "94.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P29401" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "common_name": "Human" } ], "gene": [ { "name": "TKT", "url": "https://www.uniprot.org/uniprot/P29401", "locus": { "chromosome": "3", "start_pos": 53224712, "end_pos": 53256052, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000163931", "url": "https://www.ensembl.org/id/ENSG00000163931" } ] } } ], "crossref": [ { "id": "ENSG00000163931", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163931", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P29401", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P29401", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.2.1.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.2.1.1&UniProtAcc=P29401", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd02012", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02012", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07033", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07033", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4983", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4983", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TKT", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TKT", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "7086", "url": "https://www.ncbi.nlm.nih.gov/gene/7086", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11834", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11834", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P29401", "url": "https://www.ebi.ac.uk/intact/interactors/id:P29401*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005474", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005474", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005475", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005475", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009014", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009014", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020826", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020826", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029061", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029061", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033248", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033248", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7086", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7086", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "606781", "url": "http://www.omim.org/entry/606781", "database": "MIM", "categories": [ "Other" ] }, { "id": "617044", "url": "http://www.omim.org/entry/617044", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P29401", "url": "https://www.nextprot.org/entry/NX_P29401", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "GCAPMGY", "url": "https://omabrowser.org/oma/group/GCAPMGY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "178912at2759", "url": "http://www.orthodb.org/?query=178912at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43195", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43195", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43195:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43195:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3MOS", "url": "https://www.rcsb.org/structure/3MOS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OOY", "url": "https://www.rcsb.org/structure/3OOY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4KXU", "url": "https://www.rcsb.org/structure/4KXU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4KXV", "url": "https://www.rcsb.org/structure/4KXV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4KXW", "url": "https://www.rcsb.org/structure/4KXW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4KXX", "url": "https://www.rcsb.org/structure/4KXX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4KXY", "url": "https://www.rcsb.org/structure/4KXY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HA3", "url": "https://www.rcsb.org/structure/6HA3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HAD", "url": "https://www.rcsb.org/structure/6HAD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6RJB", "url": "https://www.rcsb.org/structure/6RJB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00456", "url": "http://pfam.xfam.org/family/PF00456", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02779", "url": "http://pfam.xfam.org/family/PF02779", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02780", "url": "http://pfam.xfam.org/family/PF02780", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P29401", "url": "https://pharos.nih.gov/targets/P29401", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P29401", "url": "http://purl.obolibrary.org/obo/PR_P29401", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-163754", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163754", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "10508", "url": "https://www.rhea-db.org/rhea/10508", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "E9PFF2", "url": "https://www.uniprot.org/uniprot/E9PFF2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PFF2-1", "url": "https://www.uniprot.org/uniprot/E9PFF2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W888", "url": "https://www.uniprot.org/uniprot/F8W888", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W888-1", "url": "https://www.uniprot.org/uniprot/F8W888-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WAX4", "url": "https://www.uniprot.org/uniprot/F8WAX4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WAX4-1", "url": "https://www.uniprot.org/uniprot/F8WAX4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P29401-1", "url": "https://www.uniprot.org/uniprot/P29401-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P29401-2", "url": "https://www.uniprot.org/uniprot/P29401-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEIFKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVSIGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVGQAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVEDHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA", "length": 623, "header": "sp|P29401-1|TKT_HUMAN Isoform 1 of Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3 CANONICAL=P29401-1" }, "isoforms": [ { "isoform_ac": "E9PFF2-1", "url": "", "sequence": { "sequence": "MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKVQNSHPQGLRAGTGQAGPCQ", "length": 334, "header": "tr|E9PFF2-1|TKT_HUMAN Computationally mapped isoform of Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=1 CANONICAL=P29401-1" }, "locus": { "chromosome": "3", "start_pos": 53255942, "end_pos": 53230569, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000469678.1", "url": "https://www.ensembl.org/id/ENST00000469678.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000418340.1", "url": "https://www.ensembl.org/id/ENSP00000418340.1" } ] } }, { "isoform_ac": "F8W888-1", "url": "", "sequence": { "sequence": "MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKARHQSPGPE", "length": 153, "header": "tr|F8W888-1|F8W888_HUMAN Computationally mapped isoform of Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=1 CANONICAL=P29401-1" }, "locus": { "chromosome": "3", "start_pos": 53255942, "end_pos": 53235043, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000450814.6", "url": "https://www.ensembl.org/id/ENST00000450814.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000413503.2", "url": "https://www.ensembl.org/id/ENSP00000413503.2" } ] } }, { "isoform_ac": "F8WAX4-1", "url": "", "sequence": { "sequence": "MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGCSVFSHDREFIEIPPHVMLQRRRDHGCPLFPHHALQVPGPPESAQ", "length": 81, "header": "tr|F8WAX4-1|TKT_HUMAN Computationally mapped isoform of Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=1 CANONICAL=P29401-1" }, "locus": { "chromosome": "3", "start_pos": 53255942, "end_pos": 53242147, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000472528.5", "url": "https://www.ensembl.org/id/ENST00000472528.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000417312.1", "url": "https://www.ensembl.org/id/ENSP00000417312.1" } ] } }, { "isoform_ac": "P29401-1", "url": "", "sequence": { "sequence": "MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEIFKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVSIGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVGQAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVEDHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA", "length": 623, "header": "sp|P29401-1|TKT_HUMAN Isoform 1 of Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3 CANONICAL=P29401-1" }, "locus": { "chromosome": "3", "start_pos": 53255942, "end_pos": 53225759, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000423525.6", "url": "https://www.ensembl.org/id/ENST00000423525.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000405455.2", "url": "https://www.ensembl.org/id/ENSP00000405455.2" } ] } }, { "isoform_ac": "P29401-2", "url": "", "sequence": { "sequence": "MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASLPSSWDYSYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEIFKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVSIGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVGQAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVEDHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA", "length": 631, "header": "sp|P29401-2|TKT_HUMAN Isoform 2 of Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3 CANONICAL=P29401-1" }, "locus": { "chromosome": "3", "start_pos": 53255942, "end_pos": 53225759, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000423516.5", "url": "https://www.ensembl.org/id/ENST00000423516.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000391481.1", "url": "https://www.ensembl.org/id/ENSP00000391481.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 345, "start_aa": "Ser", "end_pos": 345, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser345", "evidence": [ { "id": "P29401", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" } ] } ], "phosphorylation": [ { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" } ], "site_lbl": "Ser104" }, { "start_pos": 275, "end_pos": 275, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "phospho.ELM", "id": "P29401", "url": "http://phospho.elm.eu.org/byAccession/P29401.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr275" }, { "start_pos": 276, "end_pos": 276, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser276" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P29401", "url": "http://phospho.elm.eu.org/byAccession/P29401.html" } ], "site_lbl": "Thr287" }, { "start_pos": 295, "end_pos": 295, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" }, { "database": "phospho.ELM", "id": "P29401", "url": "http://phospho.elm.eu.org/byAccession/P29401.html" } ], "site_lbl": "Ser295" }, { "start_pos": 345, "end_pos": 345, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "site_lbl": "Ser345" }, { "start_pos": 382, "end_pos": 382, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" }, { "database": "PubMed", "id": "24981175", "url": "https://glygen.org/publication/PubMed/24981175" } ], "site_lbl": "Thr382" }, { "start_pos": 382, "end_pos": 382, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" }, { "database": "PubMed", "id": "24981175", "url": "https://glygen.org/publication/PubMed/24981175" } ], "site_lbl": "Thr382" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" } ], "site_lbl": "Ser3" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Identification of the cDNA encoding human 6-phosphogluconolactonase, the enzyme catalyzing the second step of the pentose phosphate pathway(1).", "journal": "FEBS letters", "date": "1999", "authors": "Collard F, Collet JF, Gerin I, Veiga-da-Cunha M, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "10518023", "url": "https://glygen.org/publication/PubMed/10518023" } ] }, { "title": "The three-dimensional structure of human transaldolase.", "journal": "FEBS letters", "date": "2000", "authors": "Thorell S, Gergely P Jr, Banki K, Perl A, Schneider G", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "10869557", "url": "https://glygen.org/publication/PubMed/10869557" } ] }, { "title": "Transaldolase deficiency: liver cirrhosis associated with a new inborn error in the pentose phosphate pathway.", "journal": "American journal of human genetics", "date": "2001", "authors": "Verhoeven NM, Huck JH, Roos B, Struys EA, Salomons GS, Douwes AC, van der Knaap MS, Jakobs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "11283793", "url": "https://glygen.org/publication/PubMed/11283793" } ] }, { "title": "Identification of Nrf2-regulated genes induced by the chemopreventive agent sulforaphane by oligonucleotide microarray.", "journal": "Cancer research", "date": "2002", "authors": "Thimmulappa RK, Mai KH, Srisuma S, Kensler TW, Yamamoto M, Biswal S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "12234984", "url": "https://glygen.org/publication/PubMed/12234984" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Ribose-5-phosphate isomerase deficiency: new inborn error in the pentose phosphate pathway associated with a slowly progressive leukoencephalopathy.", "journal": "American journal of human genetics", "date": "2004", "authors": "Huck JH, Verhoeven NM, Struys EA, Salomons GS, Jakobs C, van der Knaap MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "14988808", "url": "https://glygen.org/publication/PubMed/14988808" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P29401-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401-1" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nat. Biotechnol.", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "UniProtKB", "id": "E9PFF2", "url": "https://www.uniprot.org/uniprot/E9PFF2" }, { "database": "iPTMnet", "id": "P29401-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401-1" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "Nucleotide and predicted amino acid sequence of a cDNA clone encoding part of human transketolase.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1992", "authors": "Mattick J.S., Jones S.M., Layfield R., Abedinia M., Nixon P.F.", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "reference": [ { "type": "PubMed", "id": "1567394", "url": "https://glygen.org/publication/PubMed/1567394" } ] }, { "title": "Identification and characterization of human ribokinase and comparison of its properties with E. coli ribokinase and human adenosine kinase.", "journal": "FEBS letters", "date": "2007", "authors": "Park J, van Koeverden P, Singh B, Gupta RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "17585908", "url": "https://glygen.org/publication/PubMed/17585908" } ] }, { "title": "Molecular identification of mammalian phosphopentomutase and glucose-1,6-bisphosphate synthase, two members of the alpha-D-phosphohexomutase family.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Maliekal P, Sokolova T, Vertommen D, Veiga-da-Cunha M, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "17804405", "url": "https://glygen.org/publication/PubMed/17804405" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Sedoheptulokinase deficiency due to a 57-kb deletion in cystinosis patients causes urinary accumulation of sedoheptulose: elucidation of the CARKL gene.", "journal": "Human mutation", "date": "2008", "authors": "Wamelink MM, Struys EA, Jansen EE, Levtchenko EN, Zijlstra FS, Engelke U, Blom HJ, Jakobs C, Wevers RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "18186520", "url": "https://glygen.org/publication/PubMed/18186520" } ] }, { "title": "Adenosine kinase and ribokinase--the RK family of proteins.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2008", "authors": "Park J, Gupta RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "18560757", "url": "https://glygen.org/publication/PubMed/18560757" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "iPTMnet", "id": "P29401-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Characterization of mammalian sedoheptulokinase and mechanism of formation of erythritol in sedoheptulokinase deficiency.", "journal": "FEBS letters", "date": "2008", "authors": "Kardon T, Stroobant V, Veiga-da-Cunha M, Schaftingen EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "18775706", "url": "https://glygen.org/publication/PubMed/18775706" } ] }, { "title": "Acetylation of Nrf2 by p300/CBP augments promoter-specific DNA binding of Nrf2 during the antioxidant response.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Sun Z, Chin YE, Zhang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "19273602", "url": "https://glygen.org/publication/PubMed/19273602" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "UniProtKB", "id": "E9PFF2", "url": "https://www.uniprot.org/uniprot/E9PFF2" }, { "database": "UniProtKB", "id": "F8WAX4", "url": "https://www.uniprot.org/uniprot/F8WAX4" }, { "database": "UniProtKB", "id": "F8W888", "url": "https://www.uniprot.org/uniprot/F8W888" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P29401-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "iPTMnet", "id": "P29401-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "The crystal structure of human transketolase and new insights into its mode of action.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Mitschke L, Parthier C, Schroder-Tittmann K, Coy J, Ludtke S, Tittmann K", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" } ], "reference": [ { "type": "PubMed", "id": "20667822", "url": "https://glygen.org/publication/PubMed/20667822" } ] }, { "title": "Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2011", "authors": "Liang W, Ouyang S, Shaw N, Joachimiak A, Zhang R, Liu ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "20923965", "url": "https://glygen.org/publication/PubMed/20923965" } ] }, { "title": "Beneficial role of Nrf2 in regulating NADPH generation and consumption.", "journal": "Toxicological sciences : an official journal of the Society of Toxicology", "date": "2011", "authors": "Wu KC, Cui JY, Klaassen CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "21775727", "url": "https://glygen.org/publication/PubMed/21775727" } ] }, { "title": "The sedoheptulose kinase CARKL directs macrophage polarization through control of glucose metabolism.", "journal": "Cell metabolism", "date": "2012", "authors": "Haschemi A, Kosma P, Gille L, Evans CR, Burant CF, Starkl P, Knapp B, Haas R, Schmid JA, Jandl C, Amir S, Lubec G, Park J, Esterbauer H, Bilban M, Brizuela L, Pospisilik JA, Otterbein LE, Wagner O", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "22682222", "url": "https://glygen.org/publication/PubMed/22682222" } ] }, { "title": "Nrf2 redirects glucose and glutamine into anabolic pathways in metabolic reprogramming.", "journal": "Cancer cell", "date": "2012", "authors": "Mitsuishi Y, Taguchi K, Kawatani Y, Shibata T, Nukiwa T, Aburatani H, Yamamoto M, Motohashi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "22789539", "url": "https://glygen.org/publication/PubMed/22789539" } ] }, { "title": "Nrf2-MafG heterodimers contribute globally to antioxidant and metabolic networks.", "journal": "Nucleic acids research", "date": "2012", "authors": "Hirotsu Y, Katsuoka F, Funayama R, Nagashima T, Nishida Y, Nakayama K, Engel JD, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "22965115", "url": "https://glygen.org/publication/PubMed/22965115" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" }, { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Akt phosphorylation and regulation of transketolase is a nodal point for amino acid control of purine synthesis.", "journal": "Molecular cell", "date": "2014", "authors": "Saha A, Connelly S, Jiang J, Zhuang S, Amador DT, Phan T, Pilz RB, Boss GR", "evidence": [ { "database": "iPTMnet", "id": "P29401", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29401" } ], "reference": [ { "type": "PubMed", "id": "24981175", "url": "https://glygen.org/publication/PubMed/24981175" } ] }, { "title": "DERA is the human deoxyribose phosphate aldolase and is involved in stress response.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Salleron L, Magistrelli G, Mary C, Fischer N, Bairoch A, Lane L", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "25229427", "url": "https://glygen.org/publication/PubMed/25229427" } ] }, { "title": "Phosphoribosylpyrophosphate synthesis from glucose decreases during amino acid starvation of human lymphoblasts.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Boss GR, Pilz RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "2581946", "url": "https://glygen.org/publication/PubMed/2581946" } ] }, { "title": "Proteomic analysis of O-GlcNAcylated proteins in invasive ductal breast carcinomas with and without lymph node metastasis.", "journal": "Amino acids", "date": "2016", "authors": "Jiang K, Gao Y, Hou W, Tian F, Ying W, Li L, Bai B, Hou G, Wang PG, Zhang L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "26374642", "url": "https://glygen.org/publication/PubMed/26374642" } ] }, { "title": "Comparative analysis of Cu (I)-catalyzed alkyne-azide cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) in O-GlcNAc proteomics.", "journal": "Electrophoresis", "date": "2016", "authors": "Li S, Zhu H, Wang J, Wang X, Li X, Ma C, Wen L, Yu B, Wang Y, Li J, Wang PG", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "26853435", "url": "https://glygen.org/publication/PubMed/26853435" } ] }, { "title": "Mutations in TKT are the cause of a syndrome including short stature, developmental delay, and congenital heart defects.", "journal": "Am. J. Hum. Genet.", "date": "2016", "authors": "Boyle L, Wamelink MMC, Salomons GS, Roos B, Pop A, Dauber A, Hwa V, Andrew M, Douglas J, Feingold M, Kramer N, Saitta S, Retterer K, Cho MT, Begtrup A, Monaghan KG, Wynn J, Chung WK", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "reference": [ { "type": "PubMed", "id": "27259054", "url": "https://glygen.org/publication/PubMed/27259054" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Nuclear Factor Erythroid 2-Related Factor 2 in Regulating Cancer Metabolism.", "journal": "Antioxidants & redox signaling", "date": "2020", "authors": "Smolkova K, Miko E, Kovacs T, Leguina-Ruzzi A, Sipos A, Bai P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "31989830", "url": "https://glygen.org/publication/PubMed/31989830" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "The Molecular Mechanisms Regulating the KEAP1-NRF2 Pathway.", "journal": "Molecular and cellular biology", "date": "2020", "authors": "Baird L, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "32284348", "url": "https://glygen.org/publication/PubMed/32284348" } ] }, { "title": "The Complex Interplay between Antioxidants and ROS in Cancer.", "journal": "Trends in cell biology", "date": "2020", "authors": "Harris IS, DeNicola GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "32303435", "url": "https://glygen.org/publication/PubMed/32303435" } ] }, { "title": "The positive feedback loop between Nrf2 and phosphogluconate dehydrogenase stimulates proliferation and clonogenicity of human hepatoma cells.", "journal": "Free radical research", "date": "2020", "authors": "Ong AJ, Saeidi S, Chi NHK, Kim SJ, Kim DH, Kim SH, Park SA, Cha YN, Na HK, Surh YJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "32336239", "url": "https://glygen.org/publication/PubMed/32336239" } ] }, { "title": "Studies on the nature of thiamine pyrophosphate binding and dependency on divalent cations of transketolase from human erythrocytes.", "journal": "Int. J. Biochem.", "date": "1988", "authors": "Takeuchi T., Itokawa Y., Jung E.H., Nishino K.", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "reference": [ { "type": "PubMed", "id": "3248678", "url": "https://glygen.org/publication/PubMed/3248678" } ] }, { "title": "The Role of the Pentose Phosphate Pathway in Diabetes and Cancer.", "journal": "Frontiers in endocrinology", "date": "2020", "authors": "Ge T, Yang J, Zhou S, Wang Y, Li Y, Tong X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "32582032", "url": "https://glygen.org/publication/PubMed/32582032" } ] }, { "title": "Oxidative Stress in Cancer.", "journal": "Cancer cell", "date": "2020", "authors": "Hayes JD, Dinkova-Kostova AT, Tew KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "32649885", "url": "https://glygen.org/publication/PubMed/32649885" } ] }, { "title": "Untargeted metabolomics as an unbiased approach to the diagnosis of inborn errors of metabolism of the non-oxidative branch of the pentose phosphate pathway.", "journal": "Molecular genetics and metabolism", "date": "2020", "authors": "Shayota BJ, Donti TR, Xiao J, Gijavanekar C, Kennedy AD, Hubert L, Rodan L, Vanderpluym C, Nowak C, Bjornsson HT, Ganetzky R, Berry GT, Pappan KL, Sutton VR, Sun Q, Elsea SH", "evidence": [ { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" } ], "reference": [ { "type": "PubMed", "id": "32828637", "url": "https://glygen.org/publication/PubMed/32828637" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "c-MYC-directed NRF2 drives malignant progression of head and neck cancer via glucose-6-phosphate dehydrogenase and transketolase activation.", "journal": "Theranostics", "date": "2021", "authors": "Tang YC, Hsiao JR, Jiang SS, Chang JY, Chu PY, Liu KJ, Fang HL, Lin LM, Chen HH, Huang YW, Chen YT, Tsai FY, Lin SF, Chuang YJ, Kuo CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818028", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028" } ], "reference": [ { "type": "PubMed", "id": "33859744", "url": "https://glygen.org/publication/PubMed/33859744" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "QM/MM Study of Human Transketolase: Thiamine Diphosphate Activation Mechanism and Complete Catalytic Cycle.", "journal": "Journal of chemical information and modeling", "date": "2021", "authors": "Nauton L, Hecquet L, Thery V", "evidence": [ { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" } ], "reference": [ { "type": "PubMed", "id": "34161071", "url": "https://glygen.org/publication/PubMed/34161071" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Transketolase promotes colorectal cancer metastasis through regulating AKT phosphorylation.", "journal": "Cell death & disease", "date": "2022", "authors": "Li M, Zhao X, Yong H, Xu J, Qu P, Qiao S, Hou P, Li Z, Chu S, Zheng J, Bai J", "evidence": [ { "database": "RefSeq", "id": "NP_001055", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001055" } ], "reference": [ { "type": "PubMed", "id": "35110545", "url": "https://glygen.org/publication/PubMed/35110545" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P29401", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29401" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Limiting role of 6-phosphogluconolactonase in erythrocyte hexose monophosphate pathway metabolism.", "journal": "The Journal of laboratory and clinical medicine", "date": "1985", "authors": "Beutler E, Kuhl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "3932573", "url": "https://glygen.org/publication/PubMed/3932573" } ] }, { "title": "Half-site reactivity in 6-phosphogluconate dehydrogenase from human erythrocytes.", "journal": "The Biochemical journal", "date": "1985", "authors": "Dallocchio F, Matteuzzi M, Bellini T", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "3994686", "url": "https://glygen.org/publication/PubMed/3994686" } ] }, { "title": "Biochemical genetics of the pentose phosphate cycle: human ribose 5-phosphate isomerase (RPI) and ribulose 5-phosphate 3-epimerase (RPE).", "journal": "Annals of human genetics", "date": "1980", "authors": "Spencer N, Hopkinson DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "7396409", "url": "https://glygen.org/publication/PubMed/7396409" } ] }, { "title": "Cloning and expression of the human gene for transaldolase. A novel highly repetitive element constitutes an integral part of the coding sequence.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Banki K, Halladay D, Perl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "8300619", "url": "https://glygen.org/publication/PubMed/8300619" } ] }, { "title": "Cloning of human transketolase cDNAs and comparison of the nucleotide sequence of the coding region in Wernicke-Korsakoff and non-Wernicke-Korsakoff individuals.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "McCool BA, Plonk SG, Martin PR, Singleton CK", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "reference": [ { "type": "PubMed", "id": "8419340", "url": "https://glygen.org/publication/PubMed/8419340" } ] }, { "title": "Molecular evolutionary analysis of the thiamine-diphosphate-dependent enzyme, transketolase.", "journal": "J. Mol. Evol.", "date": "1997", "authors": "Schenk G., Duggleby R.G., Layfield R., Candy J.M., Nixon P.F.", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "reference": [ { "type": "PubMed", "id": "9115179", "url": "https://glygen.org/publication/PubMed/9115179" } ] }, { "title": "Aspartate 155 of human transketolase is essential for thiamine diphosphate-magnesium binding, and cofactor binding is required for dimer formation.", "journal": "Biochimica et biophysica acta", "date": "1997", "authors": "Wang JJ, Martin PR, Singleton CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "9357955", "url": "https://glygen.org/publication/PubMed/9357955" } ] }, { "title": "6-Phosphogluconate dehydrogenase: the mechanism of action investigated by a comparison of the enzyme from different species.", "journal": "Biochimica et biophysica acta", "date": "1998", "authors": "Rippa M, Giovannini PP, Barrett MP, Dallocchio F, Hanau S", "evidence": [ { "database": "Reactome", "id": "R-HSA-71336", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336" } ], "reference": [ { "type": "PubMed", "id": "9920387", "url": "https://glygen.org/publication/PubMed/9920387" } ] } ], "pathway": [ { "id": "hsa:7086", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7086", "resource": "KEGG Pathway" }, { "id": "R-HSA-163754", "name": "Insulin effects increased synthesis of Xylulose-5-Phosphate", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163754", "resource": "Reactome", "description": "Insulin effects increased synthesis of Xylulose-5-Phosphate" }, { "id": "R-HSA-71336", "name": "Pentose phosphate pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71336", "resource": "Reactome", "description": "Pentose phosphate pathway" }, { "id": "R-HSA-9818028", "name": "NFE2L2 regulates pentose phosphate pathway genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818028", "resource": "Reactome", "description": "NFE2L2 regulates pentose phosphate pathway genes" } ], "orthologs": [ { "uniprot_canonical_ac": "P23254-1", "protein_name": "Transketolase 1", "gene_name": "TKL1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MTQFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF", "length": 680 }, "evidence": [ { "id": "P29401", "url": "https://omabrowser.org/oma/group/P29401/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P40142-1", "protein_name": "Transketolase", "gene_name": "Tkt", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEGYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKALDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLPEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCMLGDGEVSEGSVWEAMAFAGIYKLDNLVAIFDINRLGQSDPAPLQHQVDIYQKRCEAFGWHTIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGIEDKEAWHGKPLPKNMAEQIIQEIYSQVQSKKKILATPPQEDAPSVDIANIRMPTPPSYKVGDKIATRKAYGLALAKLGHASDRIIALDGDTKNSTFSELFKKEHPDRFIECYIAEQNMVSIAVGCATRDRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVSIGEDGPSQMALEDLAMFRSVPMSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYSNNEDFQVGQAKVVLKSKDDQVTVIGAGVTLHEALAAAESLKKDKISIRVLDPFTIKPLDRKLILDSARATKGRILTVEDHYYEGGIGEAVSAAVVGEPGVTVTRLAVSQVPRSGKPAELLKMFGIDKDAIVQAVKGLVTKG", "length": 623 }, "evidence": [ { "id": "45225545", "url": "http://www.informatics.jax.org/homology/45225545", "database": "MGI" }, { "id": "P29401", "url": "https://omabrowser.org/oma/group/P29401/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P50137-1", "protein_name": "Transketolase", "gene_name": "Tkt", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEGYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKALDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLPEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCMLGDGEVSEGSVWEAMAFAGIYKLDNLVAIFDINRLGQSDPAPLQHQVDVYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGIEDKEAWHGKPLPKNMAEQIIQEIYSQVQSKKKILATPPQEDAPSVDIANIRMPTPPNYKVGDKIATRKAYGLALAKLGHASDRIIALDGDTKNSTFSELFKKEHPDRFIECYIAEQNMVSIAVGCATRDRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVSIGEDGPSQMALEDLAMFRSVPMSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYSNNEDFQVGQAKVVLKSKDDQVTVIGAGVTLHEALAAAEMLKKEKIGVRVLDPFTIKPLDKKLILDCARATKGRILTVEDHYYEGGIGEAVSAVVVGEPGVTVTRLAVSQVPRSGKPAELLKMFGIDKDAIVQAVKGLVTKG", "length": 623 }, "evidence": [ { "id": "45225545", "url": "http://www.informatics.jax.org/homology/45225545", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "pentose-phosphate shunt, non-oxidative branch", "id": "GO:0009052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009052", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "regulation of growth", "id": "GO:0040008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040008", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "pentose-phosphate shunt", "id": "GO:0006098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006098", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "ribose phosphate biosynthetic process", "id": "GO:0046390", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046390", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "glyceraldehyde-3-phosphate biosynthetic process", "id": "GO:0046166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046166", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "xylulose 5-phosphate biosynthetic process", "id": "GO:1901159", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901159", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "thiamine pyrophosphate binding", "id": "GO:0030976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030976", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "transketolase activity", "id": "GO:0004802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004802", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P29401", "url": "https://www.uniprot.org/uniprot/P29401" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 344, "end_pos": 346, "annotation": "n_glycosylation_sequon" }, { "start_pos": 380, "end_pos": 382, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10508", "name": "", "equation": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P50137-1", "Q9H0I9-1", "P29401-1", "P51854-3", "P40142-1", "Q9D4D4-1", "Q99MX0-1", "P23254-1", "P33315-1", "Q556J0-1" ], "evidence": [ { "id": "10508", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10508" } ] }, { "id": "R-HSA-163741", "name": "D-glyceraldehyde 3-phosphate + sedoheptulose 7-phosphate<=> xylulose 5-phosphate+ribose 5-phosphate", "equation": "", "summary": "Cytosolic transketolase (TKT) catalyzes the reversible reaction of D-glyceraldehyde 3-phosphate and sedoheptulose 7-phosphate to form D-xylulose 5-phosphate and D-ribose 5-phosphate. The active transketolase enzyme is a homodimer with one molecule of thiamine pyrophosphate and magnesium bound to each monomer (Wang et al. 1997).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P29401-1" ], "evidence": [ { "id": "R-HSA-163741", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163741" } ] }, { "id": "R-HSA-163751", "name": "D-glyceraldehyde 3-phosphate + D-fructose 6-phosphate <=> xylulose 5-phosphate + D-erythrose 4-phosphate", "equation": "", "summary": "Cytosolic transketolase (TKT) catalyzes the reaction of D-glyceraldehyde 3-phosphate and D-fructose 6-phosphate to form D-erythrose 4-phosphate and D-xylulose 5-phosphate. The active transketolase enzyme is a homodimer with one molecule of thiamine pyrophosphate and magnesium bound to each monomer (Wang et al. 1997).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P29401-1" ], "evidence": [ { "id": "R-HSA-163751", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163751" } ] }, { "id": "R-HSA-71324", "name": "ribose 5-phosphate + xylulose 5-phosphate <=> sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate", "equation": "", "summary": "Cytosolic transketolase (TKT) catalyzes the reversible reaction of D-xylulose 5-phosphate and D-ribose 5-phosphate to form D-glyceraldehyde 3-phosphate and sedoheptulose 7-phosphate. The active transketolase enzyme is a homodimer with one molecule of thiamine pyrophosphate and magnesium bound to each monomer (Wang et al. 1997).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-29578", "R-ALL-29882" ], "enzyme_list": [ "P29401-1" ], "evidence": [ { "id": "R-HSA-71324", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71324" } ] }, { "id": "R-HSA-71335", "name": "xylulose 5-phosphate + D-erythrose 4-phosphate <=> D-glyceraldehyde 3-phosphate + D-fructose 6-phosphate", "equation": "", "summary": "Cytosolic transketolase (TKT) catalyzes the reaction of D-erythrose 4-phosphate and D-xylulose 5-phosphate to form D-glyceraldehyde 3-phosphate and D-fructose 6-phosphate. The active transketolase enzyme is a homodimer with one molecule of thiamine pyrophosphate and magnesium bound to each monomer (Wang et al. 1997).", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-29790", "R-ALL-29878" ], "output_participant_list": [], "enzyme_list": [ "P29401-1" ], "evidence": [ { "id": "R-HSA-71335", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71335" } ] }, { "id": "R-HSA-9761852", "name": "NFE2L2-dependent TKT gene expression", "equation": "", "summary": "Transketolase (TKT) encodes an enzyme responsible for two reversible reactions of the non-oxidative branch of the pentose phosphate pathway (PPP). The PPP branches off from glycolysis and diverts carbon metabolites into other biosynthetic pathways to generate NADPH, fatty acids, sterols and nucleic acids, among others (reviewed in Ge et al, 2020). NFE2L2 is a transcription factor with key roles in antioxidant response, redox balance, NADPH generation and metabolic reprogramming, including during oncogenesis (reviewed in Baird and Yamamoto, 2020; Ge et al, 2020; Smolkova et al 2020). NFE2L2 binds as a heterodimer with a member of the MAF protein family to antioxidant response elements in the promoters of target genes, including TKT and other enzymes in the PPP (Tang et al, 2021; reviewed in Baird and Yamamoto; Ge et al, 2020).", "cellular_location": "cytosol, nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P29401-1" ], "evidence": [ { "id": "R-HSA-9761852", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9761852" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-29578", "participant_name": "GA3P [cytosol]", "crossref": [ { "id": "C00118", "database": "COMPOUND", "url": "" }, { "id": "59776", "database": "ChEBI", "url": "" }, { "id": "000003869936", "database": "ZINC", "url": "" }, { "id": "C00118", "database": "COMPOUND", "url": "" }, { "id": "59776", "database": "ChEBI", "url": "" }, { "id": "000003869936", "database": "ZINC", "url": "" }, { "id": "C00118", "database": "COMPOUND", "url": "" }, { "id": "59776", "database": "ChEBI", "url": "" }, { "id": "000003869936", "database": "ZINC", "url": "" }, { "id": "C00118", "database": "COMPOUND", "url": "" }, { "id": "59776", "database": "ChEBI", "url": "" }, { "id": "000003869936", "database": "ZINC", "url": "" }, { "id": "C00118", "database": "COMPOUND", "url": "" }, { "id": "59776", "database": "ChEBI", "url": "" }, { "id": "000003869936", "database": "ZINC", "url": "" }, { "id": "C00118", "database": "COMPOUND", "url": "" }, { "id": "59776", "database": "ChEBI", "url": "" }, { "id": "000003869936", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-29790", "participant_name": "XY5P [cytosol]", "crossref": [ { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-29878", "participant_name": "E4P [cytosol]", "crossref": [ { "id": "8143600", "database": "PubChem Substance", "url": "" }, { "id": "C00279", "database": "COMPOUND", "url": "" }, { "id": "16897", "database": "ChEBI", "url": "" }, { "id": "000032786787", "database": "ZINC", "url": "" }, { "id": "8143600", "database": "PubChem Substance", "url": "" }, { "id": "C00279", "database": "COMPOUND", "url": "" }, { "id": "16897", "database": "ChEBI", "url": "" }, { "id": "000032786787", "database": "ZINC", "url": "" }, { "id": "8143600", "database": "PubChem Substance", "url": "" }, { "id": "C00279", "database": "COMPOUND", "url": "" }, { "id": "000032786787", "database": "ZINC", "url": "" }, { "id": "16897", "database": "ChEBI", "url": "" }, { "id": "C00279", "database": "COMPOUND", "url": "" }, { "id": "16897", "database": "ChEBI", "url": "" }, { "id": "8143600", "database": "PubChem Substance", "url": "" }, { "id": "000032786787", "database": "ZINC", "url": "" }, { "id": "000032786787", "database": "ZINC", "url": "" }, { "id": "16897", "database": "ChEBI", "url": "" }, { "id": "C00279", "database": "COMPOUND", "url": "" }, { "id": "8143600", "database": "PubChem Substance", "url": "" }, { "id": "C00279", "database": "COMPOUND", "url": "" }, { "id": "16897", "database": "ChEBI", "url": "" }, { "id": "8143600", "database": "PubChem Substance", "url": "" }, { "id": "000032786787", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-29882", "participant_name": "SH7P [cytosol]", "crossref": [ { "id": "C00281", "database": "COMPOUND", "url": "" }, { "id": "15721", "database": "ChEBI", "url": "" }, { "id": "000005132038", "database": "ZINC", "url": "" }, { "id": "8143365", "database": "PubChem Substance", "url": "" }, { "id": "C00281", "database": "COMPOUND", "url": "" }, { "id": "15721", "database": "ChEBI", "url": "" }, { "id": "000005132038", "database": "ZINC", "url": "" }, { "id": "8143365", "database": "PubChem Substance", "url": "" }, { "id": "C00281", "database": "COMPOUND", "url": "" }, { "id": "15721", "database": "ChEBI", "url": "" }, { "id": "000005132038", "database": "ZINC", "url": "" }, { "id": "8143365", "database": "PubChem Substance", "url": "" }, { "id": "C00281", "database": "COMPOUND", "url": "" }, { "id": "15721", "database": "ChEBI", "url": "" }, { "id": "000005132038", "database": "ZINC", "url": "" }, { "id": "8143365", "database": "PubChem Substance", "url": "" }, { "id": "15721", "database": "ChEBI", "url": "" }, { "id": "8143365", "database": "PubChem Substance", "url": "" }, { "id": "C00281", "database": "COMPOUND", "url": "" }, { "id": "000005132038", "database": "ZINC", "url": "" }, { "id": "C00281", "database": "COMPOUND", "url": "" }, { "id": "15721", "database": "ChEBI", "url": "" }, { "id": "000005132038", "database": "ZINC", "url": "" }, { "id": "8143365", "database": "PubChem Substance", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P23254", "gene_name": "TKL1", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "P23254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23254" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "P23254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23254" } ] } ] }, { "uniprot_ac": "P29401", "gene_name": "TKT", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "P29401", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29401" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "P29401", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29401" } ] } ] }, { "uniprot_ac": "P33315", "gene_name": "TKL2", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "P33315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33315" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "P33315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33315" } ] } ] }, { "uniprot_ac": "P40142", "gene_name": "Tkt", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "P40142", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40142" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "P40142", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40142" } ] } ] }, { "uniprot_ac": "P50137", "gene_name": "Tkt", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "P50137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50137" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "P50137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50137" } ] } ] }, { "uniprot_ac": "P51854", "gene_name": "TKTL1", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "P51854", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51854" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "P51854", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51854" } ] } ] }, { "uniprot_ac": "Q556J0", "gene_name": "tkt-1", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "Q556J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556J0" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "Q556J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556J0" } ] } ] }, { "uniprot_ac": "Q99MX0", "gene_name": "Tktl1", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "Q99MX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MX0" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "Q99MX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MX0" } ] } ] }, { "uniprot_ac": "Q9D4D4", "gene_name": "Tktl2", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "Q9D4D4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4D4" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "Q9D4D4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4D4" } ] } ] }, { "uniprot_ac": "Q9H0I9", "gene_name": "TKTL2", "activity": [ { "ec_number": "2.2.1.1", "activity": "D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate.", "evidence": [ { "id": "Q9H0I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0I9" } ] }, { "ec_number": "2.2.1.1", "activity": "", "evidence": [ { "id": "Q9H0I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0I9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 63 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }