{ "uniprot_canonical_ac": "P27773-1", "uniprot_ac": "P27773", "uniprot_id": "PDIA3_MOUSE", "mass": { "chemical_mass": 56678.0, "monoisotopic_mass": 56678.0 }, "refseq": { "ac": "NP_031978", "name": "protein disulfide-isomerase A3 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" }, "gene_names": [ { "name": "Pdia3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P27773", "id": "P27773" }, { "name": "58kDa; Erp; ERp57; ERp60; ERp61; Grp58; PDI; PDI-Q2; PI-PLC; Plca; PLC[a]", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978", "id": "NP_031978" }, { "name": "Erp60", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P27773", "id": "P27773" }, { "name": "Erp", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P27773", "id": "P27773" }, { "name": "Grp58", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P27773", "id": "P27773" }, { "name": "Pdia3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978", "id": "NP_031978" } ], "protein_names": [ { "name": "Protein disulfide-isomerase A3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P27773" }, { "name": "5.3.4.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "58 kDa glucose-regulated protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "58 kDa microsomal protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "Disulfide isomerase ER-60", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "ER protein 57", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "ER protein 60", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "ERp57", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "ERp60", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "Endoplasmic reticulum resident protein 57", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "Endoplasmic reticulum resident protein 60", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "p58", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27773" }, { "name": "protein disulfide-isomerase A3 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978", "id": "NP_031978" }, { "name": "protein disulfide-isomerase A3; p58; 58 kDa microsomal protein; disulfide isomerase ER-60; ER protein 57; ER protein 60; 58 kDa glucose-regulated protein; endoplasmic reticulum resident protein 57; endoplasmic reticulum resident protein 60; endoplasmic reticulum protein; glucose regulated protein, 58 kDa; phospholipase C, alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978", "id": "NP_031978" } ], "function": [ { "annotation": "Disulfide isomerase which catalyzes the formation, isomerization, and reduction or oxidation of disulfide bonds (By similarity). Associates with calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells (By similarity). Association with calcitriol does not affect its enzymatic activity (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773#function" }, { "database": "UniProtKB", "id": "P30101", "url": "https://www.uniprot.org/uniprot/P30101#function" } ] }, { "annotation": "ER Stress in ERp57 Knockout Knee Joint Chondrocytes Induces Osteoarthritic Cartilage Degradation and Osteophyte Formation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" }, { "database": "PubMed", "id": "35008608", "url": "https://glygen.org/publication/PubMed/35008608" } ] }, { "annotation": "Inhibition of PDIA3 in club cells attenuates osteopontin production and lung fibrosis.", "evidence": [ { "database": "RefSeq", "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" }, { "database": "PubMed", "id": "34400514", "url": "https://glygen.org/publication/PubMed/34400514" } ] }, { "annotation": "PDIA3 epitope-driven immune autoreactivity contributes to hepatic damage in type 2 diabetes.", "evidence": [ { "database": "RefSeq", "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" }, { "database": "PubMed", "id": "35984892", "url": "https://glygen.org/publication/PubMed/35984892" } ] }, { "annotation": "Protein Disulfide Isomerase A3 Regulates Influenza Neuraminidase Activity and Influenza Burden in the Lung. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" }, { "database": "PubMed", "id": "35162999", "url": "https://glygen.org/publication/PubMed/35162999" } ] } ], "disease": [ { "disease_id": "DOID:11088", "recommended_name": { "id": "DOID:11088", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11088", "name": "asphyxia neonatorum", "description": "A respiratory system disease that is characterized by deprivation of oxygen to a newborn infant that lasts long enough during the birth process to cause physical harm, usually to the brain." }, "synonyms": [ { "id": "DOID:11088", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11088", "name": "Asphyxia - birth", "description": "" }, { "id": "DOID:11088", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11088", "name": "Asphyxia, in liveborn infant", "description": "" }, { "id": "DOID:11088", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11088", "name": "Birth asphyxia", "description": "" }, { "id": "DOID:11088", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11088", "name": "postnatal asphyxia", "description": "" } ], "evidence": [ { "id": "11088", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11088" } ] }, { "disease_id": "DOID:2048", "recommended_name": { "id": "DOID:2048", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2048", "name": "autoimmune hepatitis", "description": "An autoimmune disease of gastrointestinal tract that results_in inflammation located_in liver caused by the body's immune system attacking the liver cells." }, "synonyms": [ { "id": "DOID:2048", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2048", "name": "Autoimmune chronic active hepatitis", "description": "" }, { "id": "DOID:2048", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2048", "name": "autoimmune hepatitis with centrilobular necrosis", "description": "" } ], "evidence": [ { "id": "2048", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2048" } ] }, { "disease_id": "DOID:2055", "recommended_name": { "id": "DOID:2055", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2055", "name": "post-traumatic stress disorder", "description": "An anxiety disorder which results from a traumatic experience that results in psychological trauma." }, "synonyms": [ { "id": "DOID:2055", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2055", "name": "traumatic neurosis", "description": "" }, { "id": "DOID:2055", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2055", "name": "PTSD", "description": "" } ], "evidence": [ { "id": "2055", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2055" } ] }, { "disease_id": "DOID:5082", "recommended_name": { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "liver cirrhosis", "description": "" }, "synonyms": [ { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "Cirrhosis", "description": "" }, { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "cirrhosis of liver", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis of liver", "description": "A disorder characterized by replacement of the liver parenchyma with fibrous tissue and regenerative nodules. It is usually caused by alcoholism, hepatitis B, and hepatitis C. Complications include the development of ascites, esophageal varices, bleeding, and hepatic encephalopathy." }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis of liver", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "liver cirrhosis", "description": "" } ], "evidence": [ { "id": "5082", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5082" } ] }, { "disease_id": "DOID:6432", "recommended_name": { "id": "DOID:6432", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6432", "name": "pulmonary hypertension", "description": "A hypertension characterized by an increase of blood pressure in the pulmonary artery, pulmonary vein or pulmonary capillaries." }, "synonyms": [], "evidence": [ { "id": "6432", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:6432" } ] }, { "disease_id": "DOID:9778", "recommended_name": { "id": "DOID:9778", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9778", "name": "irritable bowel syndrome", "description": "An intestinal disease that is characterized by chronic abdominal pain, discomfort, bloating, and alteration of bowel habits in the absence of any detectable organic cause." }, "synonyms": [ { "id": "DOID:9778", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9778", "name": "IBD", "description": "" }, { "id": "DOID:9778", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9778", "name": "Irritable colon", "description": "" } ], "evidence": [ { "id": "9778", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9778" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Pdia3", "url": "https://www.uniprot.org/uniprot/P27773", "locus": { "chromosome": "2", "start_pos": 121269168, "end_pos": 121244256, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000027248", "url": "https://www.ensembl.org/id/ENSMUSG00000027248" } ] } } ], "crossref": [ { "id": "ENSMUSG00000027248", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000027248", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "5.3.4.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=5.3.4.1&UniProtAcc=P27773", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd02995", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02995", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03069", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03069", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03073", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03073", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "14827", "url": "https://www.ncbi.nlm.nih.gov/gene/14827", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0002659", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0002659", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0003531", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0003531", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "P27773", "url": "https://www.ebi.ac.uk/intact/interactors/id:P27773*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005788", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005788", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005792", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005792", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017937", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017937", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041868", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041868", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044569", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044569", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:14827", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14827", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "95834", "url": "http://www.informatics.jax.org/marker/MGI:95834", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P27773", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P27773", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YIAKHAT", "url": "https://omabrowser.org/oma/group/YIAKHAT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5399045at2759", "url": "http://www.orthodb.org/?query=5399045at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR18929", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18929", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR18929:SF132", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18929:SF132", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45815", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45815", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45815:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45815:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00085", "url": "http://pfam.xfam.org/family/PF00085", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13848", "url": "http://pfam.xfam.org/family/PF13848", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P27773", "url": "http://purl.obolibrary.org/obo/PR_P27773", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1236974", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-901042", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-901042", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983170", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F6Q404", "url": "https://www.uniprot.org/uniprot/F6Q404", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6Q404-1", "url": "https://www.uniprot.org/uniprot/F6Q404-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P27773-1", "url": "https://www.uniprot.org/uniprot/P27773-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRFSCLALLPGVALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQREATNPPIIQEEKPKKKKKAQEDL", "length": 505, "header": "sp|P27773-1|PDIA3_MOUSE Isoform 1 of Protein disulfide-isomerase A3 OS=Mus musculus OX=10090 GN=Pdia3 PE=1 SV=2 CANONICAL=P27773-1" }, "isoforms": [ { "isoform_ac": "F6Q404-1", "url": "", "sequence": { "sequence": "ASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTAGGSLYSVHYILLTSLKTKLWHILKRK", "length": 124, "header": "tr|F6Q404-1|PDIA3_MOUSE Computationally mapped isoform of Protein disulfide-isomerase A3 OS=Mus musculus OX=10090 GN=Pdia3 PE=1 SV=1 CANONICAL=P27773-1" }, "locus": { "chromosome": "2", "start_pos": 121262209, "end_pos": 121244589, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000135079.2", "url": "https://www.ensembl.org/id/ENSMUST00000135079.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119337.2", "url": "https://www.ensembl.org/id/ENSMUSP00000119337.2" } ] } }, { "isoform_ac": "P27773-1", "url": "", "sequence": { "sequence": "MRFSCLALLPGVALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQREATNPPIIQEEKPKKKKKAQEDL", "length": 505, "header": "sp|P27773-1|PDIA3_MOUSE Isoform 1 of Protein disulfide-isomerase A3 OS=Mus musculus OX=10090 GN=Pdia3 PE=1 SV=2 CANONICAL=P27773-1" }, "locus": { "chromosome": "2", "start_pos": 121268177, "end_pos": 121244520, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000028683", "url": "https://www.ensembl.org/id/ENSMUST00000028683" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000028683", "url": "https://www.ensembl.org/id/ENSMUSP00000028683" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P27773", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P27773" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" }, { "id": "34887587", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34887587" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" } ] } ], "phosphorylation": [ { "start_pos": 319, "end_pos": 319, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "site_lbl": "Thr319" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Expression of phospholipase C isozymes by murine B lymphocytes.", "journal": "J. Immunol.", "date": "1991", "authors": "Hempel WM, DeFranco AL", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "reference": [ { "type": "PubMed", "id": "2033248", "url": "https://glygen.org/publication/PubMed/2033248" } ] }, { "title": "Glucose-regulated protein precursor (GRP78) and tumor rejection antigen (GP96) are unique to hamster caput epididymal spermatozoa.", "journal": "Asian J. Androl.", "date": "2010", "authors": "Shivaji S., Bhande S., Kameshwari D.B., Kota V., Siva A.B., Sundaram C.S.", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "reference": [ { "type": "PubMed", "id": "20400973", "url": "https://glygen.org/publication/PubMed/20400973" } ] }, { "title": "Mzb1 protein regulates calcium homeostasis, antibody secretion, and integrin activation in innate-like B cells.", "journal": "Immunity", "date": "2010", "authors": "Flach H, Rosenbaum M, Duchniewicz M, Kim S, Zhang SL, Cahalan MD, Mittler G, Grosschedl R", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "reference": [ { "type": "PubMed", "id": "21093319", "url": "https://glygen.org/publication/PubMed/21093319" } ] }, { "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Database", "id": "P27773", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P27773" } ], "reference": [ { "type": "PubMed", "id": "22645316", "url": "https://glygen.org/publication/PubMed/22645316" } ] }, { "title": "Tmem64 modulates calcium signaling during RANKL-mediated osteoclast differentiation.", "journal": "Cell Metab.", "date": "2013", "authors": "Kim H, Kim T, Jeong BC, Cho IT, Han D, Takegahara N, Negishi-Koga T, Takayanagi H, Lee JH, Sul JY, Prasad V, Lee SH, Choi Y", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "reference": [ { "type": "PubMed", "id": "23395171", "url": "https://glygen.org/publication/PubMed/23395171" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Inhibition of PDIA3 in club cells attenuates osteopontin production and lung fibrosis.", "journal": "Thorax", "date": "2022", "authors": "Kumar A, Elko E, Bruno SR, Mark ZF, Chamberlain N, Mihavics BK, Chandrasekaran R, Walzer J, Ruban M, Gold C, Lam YW, Ghandikota S, Jegga AG, Gomez JL, Janssen-Heininger YM, Anathy V", "evidence": [ { "database": "RefSeq", "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" } ], "reference": [ { "type": "PubMed", "id": "34400514", "url": "https://glygen.org/publication/PubMed/34400514" } ] }, { "title": "Dynamic eIF3a O-GlcNAcylation controls translation reinitiation during nutrient stress.", "journal": "Nature chemical biology", "date": "2022", "authors": "Shu XE, Mao Y, Jia L, Qian SB", "evidence": [ { "database": "O-GlcNAc Database", "id": "P27773", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P27773" } ], "reference": [ { "type": "PubMed", "id": "34887587", "url": "https://glygen.org/publication/PubMed/34887587" } ] }, { "title": "ER Stress in ERp57 Knockout Knee Joint Chondrocytes Induces Osteoarthritic Cartilage Degradation and Osteophyte Formation.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Rellmann Y, Eidhof E, Hansen U, Fleischhauer L, Vogel J, Clausen-Schaumann H, Aszodi A, Dreier R", "evidence": [ { "database": "RefSeq", "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" } ], "reference": [ { "type": "PubMed", "id": "35008608", "url": "https://glygen.org/publication/PubMed/35008608" } ] }, { "title": "Protein Disulfide Isomerase A3 Regulates Influenza Neuraminidase Activity and Influenza Burden in the Lung.", "journal": "International journal of molecular sciences", "date": "2022", "authors": "Chamberlain N, Ruban M, Mark ZF, Bruno SR, Kumar A, Chandrasekaran R, Souza De Lima D, Antos D, Nakada EM, Alcorn JF, Anathy V", "evidence": [ { "database": "RefSeq", "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" } ], "reference": [ { "type": "PubMed", "id": "35162999", "url": "https://glygen.org/publication/PubMed/35162999" } ] }, { "title": "PDIA3 epitope-driven immune autoreactivity contributes to hepatic damage in type 2 diabetes.", "journal": "Science immunology", "date": "2022", "authors": "Clement CC, Osan J, Buque A, Nanaware PP, Chang YC, Perino G, Shetty M, Yamazaki T, Tsai WL, Urbanska AM, Calvo-Calle JM, Ramsamooj S, Ramsamooj S, Vergani D, Mieli-Vergani G, Terziroli Beretta-Piccoli B, Gadina M, Montagna C, Goncalves MD, Sallusto F, Galluzzi L, Soni RK, Stern LJ, Santambrogio L", "evidence": [ { "database": "RefSeq", "id": "NP_031978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031978" } ], "reference": [ { "type": "PubMed", "id": "35984892", "url": "https://glygen.org/publication/PubMed/35984892" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P27773", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P27773" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] }, { "title": "Separation and sequencing of familiar and novel murine proteins using preparative two-dimensional gel electrophoresis.", "journal": "Electrophoresis", "date": "1994", "authors": "He C., Merrick B.A., Patterson R.M., Selkirk J.K., Wichter L.L.", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "reference": [ { "type": "PubMed", "id": "7523108", "url": "https://glygen.org/publication/PubMed/7523108" } ] } ], "pathway": [ { "id": "mmu:14827", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14827", "resource": "KEGG Pathway" }, { "id": "R-MMU-1236974", "name": "ER-Phagosome pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1236974", "resource": "Reactome", "description": "ER-Phagosome pathway" }, { "id": "R-MMU-901042", "name": "Calnexin/calreticulin cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-901042", "resource": "Reactome", "description": "Calnexin/calreticulin cycle" }, { "id": "R-MMU-983170", "name": "Antigen Presentation: Folding, assembly and peptide loading of class I MHC", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983170", "resource": "Reactome", "description": "Antigen Presentation: Folding, assembly and peptide loading of class I MHC" } ], "orthologs": [ { "uniprot_canonical_ac": "P11598-1", "protein_name": "Protein disulfide-isomerase A3", "gene_name": "Pdia3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRFSCLALLPGVALLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEDEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNVESLVKEYDDNGEGITIFRPLHLANKFEDKIVAYTEKKMTSGKIKKFIQESIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNTKGSNYWRNRVMMVAKTFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQEYFDGNLKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQREATNPPIIQEEKPKKKKKAQEDL", "length": 505 }, "evidence": [ { "id": "45237765", "url": "http://www.informatics.jax.org/homology/45237765", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P17967-1", "protein_name": "Protein disulfide-isomerase", "gene_name": "PDI1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLPAYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDFKLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGRHAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEKAAEEADADAELADEEDAIHDEL", "length": 522 }, "evidence": [ { "id": "P27773", "url": "https://omabrowser.org/oma/group/P27773/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P30101-1", "protein_name": "Protein disulfide-isomerase A3", "gene_name": "PDIA3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL", "length": 505 }, "evidence": [ { "id": "45237765", "url": "http://www.informatics.jax.org/homology/45237765", "database": "MGI" }, { "id": "P27773", "url": "https://omabrowser.org/oma/group/P27773/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "protein-disulfide reductase (glutathione) activity", "id": "GO:0019153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019153", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "peptidase activity", "id": "GO:0008233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008233", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "protein-disulfide reductase activity", "id": "GO:0015035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015035", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "MHC class I protein binding", "id": "GO:0042288", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042288", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "protein disulfide isomerase activity", "id": "GO:0003756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003756", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "positive regulation of protein folding", "id": "GO:1903334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903334", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "positive regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001238", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001238", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "protein folding", "id": "GO:0006457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006457", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "platelet aggregation", "id": "GO:0070527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070527", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway", "id": "GO:0097191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097191", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "response to endoplasmic reticulum stress", "id": "GO:0034976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034976", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "cellular response to vitamin D", "id": "GO:0071305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071305", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "cellular response to interleukin-7", "id": "GO:0098761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098761", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "peptide antigen assembly with MHC class I protein complex", "id": "GO:0002502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002502", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "smooth endoplasmic reticulum", "id": "GO:0005790", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005790", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "myelin sheath", "id": "GO:0043209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043209", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "acrosomal vesicle", "id": "GO:0001669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001669", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "MHC class I peptide loading complex", "id": "GO:0042824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042824", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "TAP complex", "id": "GO:0042825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042825", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" }, { "name": "Tapasin-ERp57 complex", "id": "GO:0061779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061779", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated.", "evidence": [ { "database": "UniProtKB", "id": "P27773", "url": "https://www.uniprot.org/uniprot/P27773" }, { "database": "PubMed", "id": "SIPD967ACE1525DB484", "url": "https://glygen.org/publication/PubMed/SIPD967ACE1525DB484" } ] } ], "interactions": [], "reactions": [ { "id": "R-MMU-8863973", "name": "Fusion of ERC and phagosome", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "phagocytic vesicle membrane, recycling endosome membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P27773-1" ], "evidence": [ { "id": "R-MMU-8863973", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8863973" } ] }, { "id": "R-MMU-8951499", "name": "Loading of antigenic peptides on to class I MHC", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane, integral component of lumenal side of endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P27773-1", "P21958-1", "P36371-1" ], "evidence": [ { "id": "R-MMU-8951499", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8951499" } ] }, { "id": "R-MMU-901047", "name": "Binding of ERp57", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P27773-1" ], "evidence": [ { "id": "R-MMU-901047", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-901047" } ] }, { "id": "R-MMU-983142", "name": "Formation of peptide loading complex (PLC)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane, integral component of lumenal side of endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P27773-1", "P21958-1", "P36371-1" ], "evidence": [ { "id": "R-MMU-983142", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983142" } ] }, { "id": "R-MMU-983146", "name": "Interaction of beta-2-microglobulin (B2M) chain with class I HC", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, integral component of lumenal side of endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P20029-1", "P27773-1" ], "evidence": [ { "id": "R-MMU-983146", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983146" } ] }, { "id": "R-MMU-983160", "name": "Interaction of Erp57 with MHC class I HC", "equation": "", "summary": "Endoplasmic reticulum resident protein 57 (ERp57), is a member of the protein disulphide isomerase (PDI) family of thiol oxidoreducatases. It associates with Calnexin (CNX), and its soluble homolog calreticulin (CRT) and is recruited to MHC Class I Heavy Chain (HC). ERp57 is involved in the formation of HC disulphide bonds.", "cellular_location": "endoplasmic reticulum lumen, integral component of lumenal side of endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P27773-1" ], "evidence": [ { "id": "R-MMU-983160", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983160" } ] }, { "id": "R-MMU-983161", "name": "Dissociation of the Antigenic peptide:MHC:B2M peptide loading complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane, integral component of lumenal side of endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P27773-1", "P21958-1", "P36371-1" ], "evidence": [ { "id": "R-MMU-983161", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983161" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P20029", "gene_name": "Hspa5", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P20029", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20029" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P20029", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20029" } ] } ] }, { "uniprot_ac": "P21958", "gene_name": "Tap1", "activity": [ { "ec_number": "7.4.2.14", "activity": "a peptide antigen(in) + ATP + H2O = a peptide antigen(out) + ADP + H(+) + phosphate.", "evidence": [ { "id": "P21958", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21958" } ] }, { "ec_number": "7.4.2.14", "activity": "", "evidence": [ { "id": "P21958", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21958" } ] } ] }, { "uniprot_ac": "P27773", "gene_name": "Pdia3", "activity": [ { "ec_number": "5.3.4.1", "activity": "Catalyzes the rearrangement of -S-S- bonds in proteins.", "evidence": [ { "id": "P27773", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27773" } ] }, { "ec_number": "5.3.4.1", "activity": "", "evidence": [ { "id": "P27773", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27773" } ] } ] }, { "uniprot_ac": "P36371", "gene_name": "Tap2", "activity": [ { "ec_number": "7.4.2.14", "activity": "a peptide antigen(in) + ATP + H2O = a peptide antigen(out) + ADP + H(+) + phosphate.", "evidence": [ { "id": "P36371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36371" } ] }, { "ec_number": "7.4.2.14", "activity": "", "evidence": [ { "id": "P36371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36371" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }