{ "uniprot_canonical_ac": "P27680-1", "uniprot_ac": "P27680", "uniprot_id": "COQ3_YEAST", "mass": { "chemical_mass": 36331.0, "monoisotopic_mass": 36331.0 }, "refseq": { "ac": "NP_014545", "name": "hexaprenyldihydroxybenzoate methyltransferase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014545" }, "gene_names": [ { "name": "COQ3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P27680", "id": "P27680" }, { "name": "COQ3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014545", "id": "NP_014545" }, { "name": "HRF316", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P27680", "id": "P27680" } ], "protein_names": [ { "name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P27680" }, { "name": "2.1.1.114", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "2.1.1.64", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "3-demethylubiquinol 3-O-methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "3-demethylubiquinone-6 3-O-methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "DHHB methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "DHHB-MTase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "DHHB-MT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "Hexaprenyldihydroxybenzoate methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "Polyprenyldihydroxybenzoate methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27680" }, { "name": "hexaprenyldihydroxybenzoate methyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014545", "id": "NP_014545" } ], "function": [ { "annotation": "O-methyltransferase that catalyzes the 2 O-methylation steps in the ubiquinone biosynthetic pathway. Catalyzes the methylation of 3,4-dihydroxy-5-hexaprenylbenzoate (DHHB) to 3-methoxy-4-hydroxy-5-hexaprenylbenzoate (HMHB) and the methylation of 2-hexaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinol (3-demethylubiquinol-6) to ubiquinol-6.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680#function" }, { "database": "PubMed", "id": "10419476", "url": "https://glygen.org/publication/PubMed/10419476" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "common_name": "Yeast" } ], "gene": [ { "name": "COQ3", "url": "https://www.uniprot.org/uniprot/P27680", "locus": {} } ], "crossref": [ { "id": "2.1.1.114", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.114&UniProtAcc=P27680", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "2.1.1.222", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.222&UniProtAcc=P27680", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "2.1.1.64", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.64&UniProtAcc=P27680", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd02440", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02440", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "854057", "url": "https://www.ncbi.nlm.nih.gov/gene/854057", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P27680", "url": "https://www.ebi.ac.uk/intact/interactors/id:P27680*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR010233", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010233", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YOL096C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL096C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LASRWWD", "url": "https://omabrowser.org/oma/group/LASRWWD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1459at2759", "url": "http://www.orthodb.org/?query=1459at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43464", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43464", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43464:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43464:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13489", "url": "http://pfam.xfam.org/family/PF13489", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P27680", "url": "http://purl.obolibrary.org/obo/PR_P27680", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014545", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014545", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005456", "url": "https://www.yeastgenome.org/locus/S000005456", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P27680-1", "url": "https://www.uniprot.org/uniprot/P27680-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLLRSRFLKVIHVRKQLSACSRFAIQTQTRCKSTDASEDEVKHFQELAPTWWDTDGSQRILHKMNLTRLDFVQRTVRNQVKIQNPEIFVPGFNYKEFLPEYVCDNIQREMQESIETNLDKRPEVSVLDVGCGGGILSESLARLKWVKNVQGIDLTRDCIMVAKEHAKKDPMLEGKINYECKALEDVTGQFDIITCMEMLEHVDMPSEILRHCWSRLNPEKGILFLSTINRDLISWFTTIFMGENVLKIVPKGTHHLSKYINSKEILAWFNDNYSGQFRLLDLKGTMYLPYQGWVEHDCSDVGNYFMAIQRLN", "length": 312, "header": "sp|P27680-1|COQ3_YEAST Isoform 1 of Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae S288C OX=559292 GN=COQ3 PE=1 SV=2 CANONICAL=P27680-1" }, "isoforms": [ { "isoform_ac": "P27680-1", "url": "", "sequence": { "sequence": "MLLRSRFLKVIHVRKQLSACSRFAIQTQTRCKSTDASEDEVKHFQELAPTWWDTDGSQRILHKMNLTRLDFVQRTVRNQVKIQNPEIFVPGFNYKEFLPEYVCDNIQREMQESIETNLDKRPEVSVLDVGCGGGILSESLARLKWVKNVQGIDLTRDCIMVAKEHAKKDPMLEGKINYECKALEDVTGQFDIITCMEMLEHVDMPSEILRHCWSRLNPEKGILFLSTINRDLISWFTTIFMGENVLKIVPKGTHHLSKYINSKEILAWFNDNYSGQFRLLDLKGTMYLPYQGWVEHDCSDVGNYFMAIQRLN", "length": 312, "header": "sp|P27680-1|COQ3_YEAST Isoform 1 of Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae S288C OX=559292 GN=COQ3 PE=1 SV=2 CANONICAL=P27680-1" }, "locus": { "chromosome": "XV", "start_pos": 139045, "end_pos": 138110, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YOL096C_mRNA", "url": "https://www.ensembl.org/id/YOL096C_mRNA" }, { "database": "Ensembl Peptide", "id": "YOL096C", "url": "https://www.ensembl.org/id/YOL096C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Yeast and rat Coq3 and Escherichia coli UbiG polypeptides catalyze both O-methyltransferase steps in coenzyme Q biosynthesis.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Poon WW, Barkovich RJ, Hsu AY, Frankel A, Lee PT, Shepherd JN, Myles DC, Clarke CF", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "10419476", "url": "https://glygen.org/publication/PubMed/10419476" } ] }, { "title": "Sequencing and comparison of yeast species to identify genes and regulatory elements.", "journal": "Nature", "date": "2003", "authors": "Birren B.W., Lander E.S., Kellis M., Patterson N., Endrizzi M.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "12748633", "url": "https://glygen.org/publication/PubMed/12748633" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The proteome of Saccharomyces cerevisiae mitochondria.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Sickmann A., Zahedi R.P., Rehling P., Chacinska A., Guiard B., Meyer H.E., Meisinger C., Reinders J., Pfanner N., Joppich C., Perschil I., Schoenfisch B., Wagner Y.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "14576278", "url": "https://glygen.org/publication/PubMed/14576278" } ] }, { "title": "Coq3 and Coq4 define a polypeptide complex in yeast mitochondria for the biosynthesis of coenzyme Q.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Gin P., Clarke C.F., Faull K.F., Marbois B.N., Lee P.T., Poon W.W., Shepherd J.N., Strahan J.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "15792955", "url": "https://glygen.org/publication/PubMed/15792955" } ] }, { "title": "Ubiquinone biosynthesis in Saccharomyces cerevisiae. Isolation and sequence of COQ3, the 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase gene.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Clarke C.F., Teruya J.H., Williams W.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "1885593", "url": "https://glygen.org/publication/PubMed/1885593" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Coenzyme Q supplementation or over-expression of the yeast Coq8 putative kinase stabilizes multi-subunit Coq polypeptide complexes in yeast coq null mutants.", "journal": "Biochim. Biophys. Acta", "date": "2014", "authors": "Allan C.M., He C.H., Clarke C.F., Tran U.C., Xie L.X.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "24406904", "url": "https://glygen.org/publication/PubMed/24406904" } ] }, { "title": "Sequence analysis of a 44 kb DNA fragment of yeast chromosome XV including the Ty1-H3 retrotransposon, the suf1(+) frameshift suppressor gene for tRNA-Gly, the yeast transfer RNA-Thr-1a and a delta element.", "journal": "Yeast", "date": "1995", "authors": "Durand P., Portetelle D., Vandenbol M., Hilger F.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "7502582", "url": "https://glygen.org/publication/PubMed/7502582" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "reference": [ { "type": "PubMed", "id": "9169874", "url": "https://glygen.org/publication/PubMed/9169874" } ] } ], "pathway": [ { "id": "sce:YOL096C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL096C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q63159-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "Coq3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWRGGRLSSRGVRFLETLGFACPSAVAEPPRVTSWTAFSGNQLTRNLQIKPWEFSGHRTMWLRSYRITFSCLTRLKTYRSSWKKLYSTSQTVDSKEVKTFQALAHSWWDEQGKFAPLHSMNDLRVPFIRDNLLKTSTNHDPGKPLSGMKILDVGCGGGLLTEPLGRLGASVVGIDPVAENIKIAQHHKSFDPVLDKRIQYRVCSLEETLNENAECFDAVVASEVVEHVNNLEMFIQCCYQVLKPGGSLFITTVNKTQLSYVLGIVFSEQIAGIVPKGTHTWEKFVSPEKLESILEPNGLSVETVAGMVYNPFSGYWHWTENTSLNYAAHAVRARAQEHLEPAESA", "length": 345 }, "evidence": [ { "id": "P27680", "url": "https://omabrowser.org/oma/group/P27680/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8BMS4-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "Coq3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWRGGRLGSRGVRLLETLGFGCPSAVAQPPRLTSRSAYSGTQLTRNLQIKPWELGEHGTMCFRSYRMALSCLSRVKTYRTPWKRLYSTSQTTVDSREVKNFQALAHTWWDEYGKFAPLHSMNDLRVPFIRDNLLKTSASHHPGKPLSGMKILDVGCGGGLLTEPLGRLGASVVGIDPVAENIKIAQHHKSFDPVLDKRIQYKVCSLEEAVDESAECFDAVVASEVVEHVSHLEMFIQCCYQVLKPGGSLFITTVNKTQLSYALGIVFAEQIAGIVPKGTHTWEKFVSPEKLESILEPNGLSVETVAGLVYNPFSGYWHWSENTSLNYAAHAVRSRAQEHQEPAESALKGETGALHANTSGSPSVREEQRT", "length": 370 }, "evidence": [ { "id": "P27680", "url": "https://omabrowser.org/oma/group/P27680/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MWSGRKLGSSGGWFLRVLGPGGCNTKAARPLISSAVYVKNQLSGTLQIKPGVFNEYRTIWFKSYRTIFSCLNRIKSFRYPWARLYSTSQTTVDSGEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPVDENIKTAQCHKSFDPVLDKRIEYRVCSLEEIVEETAETFDAVVASEVVEHVIDLETFLQCCCQVLKPGGSLFITTINKTQLSYALGIVFSEQIASIVPKGTHTWEKFVSPETLESILESNGLSVQTVVGMLYNPFSGYWHWSENTSLNYAAYAVKSRVQEHPASAEFVLKGETEELQANACTNPAVHEKLKK", "length": 369 }, "evidence": [ { "id": "P27680", "url": "https://omabrowser.org/oma/group/P27680/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extrinsic component of mitochondrial inner membrane", "id": "GO:0031314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031314", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "ubiquinone biosynthetic process", "id": "GO:0006744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006744", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" }, { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity", "id": "GO:0008425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008425", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" }, { "name": "hexaprenyldihydroxybenzoate methyltransferase activity", "id": "GO:0004395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004395", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" }, { "name": "3-demethylubiquinone-9 3-O-methyltransferase activity", "id": "GO:0008689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008689", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" }, { "name": "3-demethylubiquinol-6 3-O-methyltransferase activity", "id": "GO:0061543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061543", "evidence": [ { "database": "UniProtKB", "id": "P27680", "url": "https://www.uniprot.org/uniprot/P27680" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 272, "end_pos": 274, "annotation": "n_glycosylation_sequon" }, { "start_pos": 65, "end_pos": 67, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "44380", "name": "", "equation": "a 3-demethylubiquinol + S-adenosyl-L-methionine = a ubiquinol + H(+) + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q63159-1", "Q9NZJ6-1", "Q8BMS4-1", "P27680-1", "Q54XD0-1", "Q9VIF3-1" ], "evidence": [ { "id": "44380", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44380" } ] }, { "id": "44452", "name": "", "equation": "3,4-dihydroxy-5-all-trans-polyprenylbenzoate + S-adenosyl-L-methionine = 3-methoxy,4-hydroxy-5-all-trans-polyprenylbenzoate + H(+) + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q63159-1", "Q9NZJ6-1", "Q8BMS4-1", "P27680-1", "Q54XD0-1", "Q9VIF3-1" ], "evidence": [ { "id": "44452", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44452" } ] }, { "id": "R-SCE-2162186", "name": "DeMQ10H2 is methylated to Q10H2 by COQ3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [ "R-ALL-2162212" ], "output_participant_list": [ "R-ALL-2162198" ], "enzyme_list": [ "P27680-1" ], "evidence": [ { "id": "R-SCE-2162186", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-2162186" } ] }, { "id": "R-SCE-2162193", "name": "DHDB is methylated to MHDB by COQ3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [ "R-ALL-2162209" ], "output_participant_list": [ "R-ALL-2162215" ], "enzyme_list": [ "P27680-1" ], "evidence": [ { "id": "R-SCE-2162193", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-2162193" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-2162198", "participant_name": "Q10H2 [mitochondrial matrix]", "crossref": [ { "id": "64183", "database": "ChEBI", "url": "" }, { "id": "000085574641", "database": "ZINC", "url": "" }, { "id": "HMDB0013111", "database": "HMDB Metabolite", "url": "" }, { "id": "64183", "database": "ChEBI", "url": "" }, { "id": "000085574641", "database": "ZINC", "url": "" }, { "id": "HMDB0013111", "database": "HMDB Metabolite", "url": "" }, { "id": "64183", "database": "ChEBI", "url": "" }, { "id": "000085574641", "database": "ZINC", "url": "" }, { "id": "HMDB0013111", "database": "HMDB Metabolite", "url": "" }, { "id": "64183", "database": "ChEBI", "url": "" }, { "id": "000085574641", "database": "ZINC", "url": "" }, { "id": "HMDB0013111", "database": "HMDB Metabolite", "url": "" }, { "id": "64183", "database": "ChEBI", "url": "" }, { "id": "HMDB0013111", "database": "HMDB Metabolite", "url": "" }, { "id": "000085574641", "database": "ZINC", "url": "" }, { "id": "64183", "database": "ChEBI", "url": "" }, { "id": "000085574641", "database": "ZINC", "url": "" }, { "id": "HMDB0013111", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-2162209", "participant_name": "DHDB [mitochondrial matrix]", "crossref": [ { "id": "50775", "database": "ChEBI", "url": "" }, { "id": "000087515529", "database": "ZINC", "url": "" }, { "id": "HMDB0060249", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0060249", "database": "HMDB Metabolite", "url": "" }, { "id": "50775", "database": "ChEBI", "url": "" }, { "id": "000087515529", "database": "ZINC", "url": "" }, { "id": "000087515529", "database": "ZINC", "url": "" }, { "id": "50775", "database": "ChEBI", "url": "" }, { "id": "HMDB0060249", "database": "HMDB Metabolite", "url": "" }, { "id": "50775", "database": "ChEBI", "url": "" }, { "id": "000087515529", "database": "ZINC", "url": "" }, { "id": "HMDB0060249", "database": "HMDB Metabolite", "url": "" }, { "id": "50775", "database": "ChEBI", "url": "" }, { "id": "HMDB0060249", "database": "HMDB Metabolite", "url": "" }, { "id": "000087515529", "database": "ZINC", "url": "" }, { "id": "HMDB0060249", "database": "HMDB Metabolite", "url": "" }, { "id": "50775", "database": "ChEBI", "url": "" }, { "id": "000087515529", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2162212", "participant_name": "DeMQ10H2 [mitochondrial matrix]", "crossref": [ { "id": "64182", "database": "ChEBI", "url": "" }, { "id": "000087528826", "database": "ZINC", "url": "" }, { "id": "HMDB0062350", "database": "HMDB Metabolite", "url": "" }, { "id": "64182", "database": "ChEBI", "url": "" }, { "id": "000087528826", "database": "ZINC", "url": "" }, { "id": "HMDB0062350", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0062350", "database": "HMDB Metabolite", "url": "" }, { "id": "64182", "database": "ChEBI", "url": "" }, { "id": "000087528826", "database": "ZINC", "url": "" }, { "id": "64182", "database": "ChEBI", "url": "" }, { "id": "000087528826", "database": "ZINC", "url": "" }, { "id": "HMDB0062350", "database": "HMDB Metabolite", "url": "" }, { "id": "64182", "database": "ChEBI", "url": "" }, { "id": "HMDB0062350", "database": "HMDB Metabolite", "url": "" }, { "id": "000087528826", "database": "ZINC", "url": "" }, { "id": "64182", "database": "ChEBI", "url": "" }, { "id": "000087528826", "database": "ZINC", "url": "" }, { "id": "HMDB0062350", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-2162215", "participant_name": "MHDB [mitochondrial matrix]", "crossref": [ { "id": "50776", "database": "ChEBI", "url": "" }, { "id": "HMDB0060252", "database": "HMDB Metabolite", "url": "" }, { "id": "000087515532", "database": "ZINC", "url": "" }, { "id": "50776", "database": "ChEBI", "url": "" }, { "id": "HMDB0060252", "database": "HMDB Metabolite", "url": "" }, { "id": "000087515532", "database": "ZINC", "url": "" }, { "id": "50776", "database": "ChEBI", "url": "" }, { "id": "HMDB0060252", "database": "HMDB Metabolite", "url": "" }, { "id": "000087515532", "database": "ZINC", "url": "" }, { "id": "50776", "database": "ChEBI", "url": "" }, { "id": "HMDB0060252", "database": "HMDB Metabolite", "url": "" }, { "id": "000087515532", "database": "ZINC", "url": "" }, { "id": "HMDB0060252", "database": "HMDB Metabolite", "url": "" }, { "id": "000087515532", "database": "ZINC", "url": "" }, { "id": "50776", "database": "ChEBI", "url": "" }, { "id": "50776", "database": "ChEBI", "url": "" }, { "id": "HMDB0060252", "database": "HMDB Metabolite", "url": "" }, { "id": "000087515532", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P27680", "gene_name": "COQ3", "activity": [ { "ec_number": "2.1.1.114", "activity": "3,4-dihydroxy-5-all-trans-decaprenylbenzoate + S-adenosyl-L-methionine = 3-methoxy-4-hydroxy-5-all-trans-decaprenylbenzoate + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P27680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27680" } ] }, { "ec_number": "2.1.1.64", "activity": "3-demethylubiquinol-9 + S-adenosyl-L-methionine = H(+) + S-adenosyl-L-homocysteine + ubiquinol-9.", "evidence": [ { "id": "P27680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27680" } ] } ] }, { "uniprot_ac": "Q54XD0", "gene_name": "coq3", "activity": [ { "ec_number": "2.1.1.114", "activity": "3,4-dihydroxy-5-all-trans-decaprenylbenzoate + S-adenosyl-L-methionine = 3-methoxy-4-hydroxy-5-all-trans-decaprenylbenzoate + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54XD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XD0" } ] }, { "ec_number": "2.1.1.64", "activity": "3-demethylubiquinol-9 + S-adenosyl-L-methionine = H(+) + S-adenosyl-L-homocysteine + ubiquinol-9.", "evidence": [ { "id": "Q54XD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XD0" } ] } ] }, { "uniprot_ac": "Q63159", "gene_name": "Coq3", "activity": [ { "ec_number": "2.1.1.114", "activity": "3,4-dihydroxy-5-all-trans-decaprenylbenzoate + S-adenosyl-L-methionine = 3-methoxy-4-hydroxy-5-all-trans-decaprenylbenzoate + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q63159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63159" } ] }, { "ec_number": "2.1.1.64", "activity": "3-demethylubiquinol-9 + S-adenosyl-L-methionine = H(+) + S-adenosyl-L-homocysteine + ubiquinol-9.", "evidence": [ { "id": "Q63159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63159" } ] } ] }, { "uniprot_ac": "Q8BMS4", "gene_name": "Coq3", "activity": [ { "ec_number": "2.1.1.114", "activity": "3,4-dihydroxy-5-all-trans-decaprenylbenzoate + S-adenosyl-L-methionine = 3-methoxy-4-hydroxy-5-all-trans-decaprenylbenzoate + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8BMS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BMS4" } ] }, { "ec_number": "2.1.1.64", "activity": "3-demethylubiquinol-9 + S-adenosyl-L-methionine = H(+) + S-adenosyl-L-homocysteine + ubiquinol-9.", "evidence": [ { "id": "Q8BMS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BMS4" } ] } ] }, { "uniprot_ac": "Q9NZJ6", "gene_name": "COQ3", "activity": [ { "ec_number": "2.1.1.114", "activity": "3,4-dihydroxy-5-all-trans-decaprenylbenzoate + S-adenosyl-L-methionine = 3-methoxy-4-hydroxy-5-all-trans-decaprenylbenzoate + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NZJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZJ6" } ] }, { "ec_number": "2.1.1.64", "activity": "3-demethylubiquinol-9 + S-adenosyl-L-methionine = H(+) + S-adenosyl-L-homocysteine + ubiquinol-9.", "evidence": [ { "id": "Q9NZJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZJ6" } ] } ] }, { "uniprot_ac": "Q9VIF3", "gene_name": "Coq3", "activity": [ { "ec_number": "2.1.1.114", "activity": "3,4-dihydroxy-5-all-trans-decaprenylbenzoate + S-adenosyl-L-methionine = 3-methoxy-4-hydroxy-5-all-trans-decaprenylbenzoate + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9VIF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VIF3" } ] }, { "ec_number": "2.1.1.64", "activity": "3-demethylubiquinol-9 + S-adenosyl-L-methionine = H(+) + S-adenosyl-L-homocysteine + ubiquinol-9.", "evidence": [ { "id": "Q9VIF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VIF3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }