{ "uniprot_canonical_ac": "P27515-1", "uniprot_ac": "P27515", "uniprot_id": "URK1_YEAST", "mass": { "chemical_mass": 56296.0, "monoisotopic_mass": 56296.0 }, "refseq": { "ac": "NP_014409", "name": "uridine kinase URK1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014409" }, "gene_names": [ { "name": "URK1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P27515", "id": "P27515" }, { "name": "N2050", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P27515", "id": "P27515" }, { "name": "URK1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014409", "id": "NP_014409" } ], "protein_names": [ { "name": "Uridine kinase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P27515" }, { "name": "2.7.1.48", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27515" }, { "name": "Uridine monophosphokinase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27515" }, { "name": "uridine kinase URK1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014409", "id": "NP_014409" } ], "function": [ { "annotation": "Catalyzes the conversion of uridine into UMP and cytidine into CMP in the pyrimidine salvage pathway.", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515#function" }, { "database": "PubMed", "id": "2169608", "url": "https://glygen.org/publication/PubMed/2169608" }, { "database": "PubMed", "id": "10501935", "url": "https://glygen.org/publication/PubMed/10501935" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "common_name": "Yeast" } ], "gene": [ { "name": "URK1", "url": "https://www.uniprot.org/uniprot/P27515", "locus": {} } ], "crossref": [ { "id": "cd02023", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02023", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "855746", "url": "https://www.ncbi.nlm.nih.gov/gene/855746", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P27515", "url": "https://www.ebi.ac.uk/intact/interactors/id:P27515*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000764", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000764", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNR012W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNR012W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "P27515", "url": "https://oglcnac.org/atlas/detail/P27515", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P27515", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P27515", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "EPQLHCE", "url": "https://omabrowser.org/oma/group/EPQLHCE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "180154at2759", "url": "http://www.orthodb.org/?query=180154at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10285", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10285", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10285:SF215", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10285:SF215", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00485", "url": "http://pfam.xfam.org/family/PF00485", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14681", "url": "http://pfam.xfam.org/family/PF14681", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P27515", "url": "http://purl.obolibrary.org/obo/PR_P27515", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014409", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014409", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005295", "url": "https://www.yeastgenome.org/locus/S000005295", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P27515-1", "url": "https://www.uniprot.org/uniprot/P27515-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSHRIAPSKERSSSFISILDDETRDTLKANAVMDGEVDVKKTKGKSSRYIPPWTTPYIIGIGGASGSGKTSVAAKIVSSINVPWTVLISLDNFYNPLGPEDRARAFKNEYDFDEPNAINLDLAYKCILNLKEGKRTNIPVYSFVHHNRVPDKNIVIYGASVVVIEGIYALYDRRLLDLMDLKIYVDADLDVCLARRLSRDIVSRGRDLDGCIQQWEKFVKPNAVKFVKPTMKNADAIIPSMSDNATAVNLIINHIKSKLELKSNEHLRELIKLGSSPSQDVLNRNIIHELPPTNQVLSLHTMLLNKNLNCADFVFYFDRLATILLSWALDDIPVAHTNIITPGEHTMENVIACQFDQVTAVNIIRSGDCFMKSLRKTIPNITIGKLLIQSDSQTGEPQLHCEFLPPNIEKFGKVFLMEGQIISGAAMIMAIQVLLDHGIDLEKISVVVYLATEVGIRRILNAFDNKVNIFAGMIISREKLQNHQYKWALTRFFDSKYFGCD", "length": 501, "header": "sp|P27515-1|URK1_YEAST Isoform 1 of Uridine kinase OS=Saccharomyces cerevisiae S288C OX=559292 GN=URK1 PE=1 SV=1 CANONICAL=P27515-1" }, "isoforms": [ { "isoform_ac": "P27515-1", "url": "", "sequence": { "sequence": "MSHRIAPSKERSSSFISILDDETRDTLKANAVMDGEVDVKKTKGKSSRYIPPWTTPYIIGIGGASGSGKTSVAAKIVSSINVPWTVLISLDNFYNPLGPEDRARAFKNEYDFDEPNAINLDLAYKCILNLKEGKRTNIPVYSFVHHNRVPDKNIVIYGASVVVIEGIYALYDRRLLDLMDLKIYVDADLDVCLARRLSRDIVSRGRDLDGCIQQWEKFVKPNAVKFVKPTMKNADAIIPSMSDNATAVNLIINHIKSKLELKSNEHLRELIKLGSSPSQDVLNRNIIHELPPTNQVLSLHTMLLNKNLNCADFVFYFDRLATILLSWALDDIPVAHTNIITPGEHTMENVIACQFDQVTAVNIIRSGDCFMKSLRKTIPNITIGKLLIQSDSQTGEPQLHCEFLPPNIEKFGKVFLMEGQIISGAAMIMAIQVLLDHGIDLEKISVVVYLATEVGIRRILNAFDNKVNIFAGMIISREKLQNHQYKWALTRFFDSKYFGCD", "length": 501, "header": "sp|P27515-1|URK1_YEAST Isoform 1 of Uridine kinase OS=Saccharomyces cerevisiae S288C OX=559292 GN=URK1 PE=1 SV=1 CANONICAL=P27515-1" }, "locus": { "chromosome": "XIV", "start_pos": 648934, "end_pos": 647432, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YNR012W_mRNA", "url": "https://www.ensembl.org/id/YNR012W_mRNA" }, { "database": "Ensembl Peptide", "id": "YNR012W", "url": "https://www.ensembl.org/id/YNR012W" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 136, "start_aa": "Thr", "end_pos": 136, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr136", "evidence": [ { "id": "P27515", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P27515" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 142, "start_aa": "Ser", "end_pos": 142, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser142", "evidence": [ { "id": "P27515", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P27515" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P27515", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P27515" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] } ], "phosphorylation": [ { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ], "site_lbl": "Ser12" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" }, { "database": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P27515", "url": "https://www.yeastgenome.org/locus/P27515" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser14" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P27515", "url": "https://www.yeastgenome.org/locus/P27515" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser17" }, { "start_pos": 275, "end_pos": 275, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser275" }, { "start_pos": 276, "end_pos": 276, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P27515", "url": "https://www.yeastgenome.org/locus/P27515" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser276" }, { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P27515", "url": "https://www.yeastgenome.org/locus/P27515" } ], "site_lbl": "Ser278" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "New insights into the pyrimidine salvage pathway of Saccharomyces cerevisiae: requirement of six genes for cytidine metabolism.", "journal": "Curr. Genet.", "date": "1999", "authors": "Erbs P., Exinger F., Jund R., Kurtz J.-E.", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "reference": [ { "type": "PubMed", "id": "10501935", "url": "https://glygen.org/publication/PubMed/10501935" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.", "journal": "Mol. Cell. Proteomics", "date": "2005", "authors": "Gruhler Albrecht, Olsen Jesper V, Mohammed Shabaz, Mortensen Peter, Faergeman Nils J, Mann Matthias, Jensen Ole N", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" }, { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" } ], "reference": [ { "type": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" }, { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Mol. Cell. Proteomics", "date": "2008", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" }, { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" }, { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.", "journal": "Molecular biology of the cell", "date": "2010-10-01", "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N", "evidence": [ { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" } ], "reference": [ { "type": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "The URK1 gene of Saccharomyces cerevisiae encoding uridine kinase.", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Kern L.", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "reference": [ { "type": "PubMed", "id": "2169608", "url": "https://glygen.org/publication/PubMed/2169608" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P27515", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27515" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Identification of novel O-GlcNAc transferase substrates using yeast cells expressing OGT.", "journal": "The Journal of general and applied microbiology", "date": "2021-04-16", "authors": "Li Feng, Yang Ganglong, Tachikawa Hiroyuki, Shao Kankai, Yang Yan, Gao Xiao-Dong, Nakanishi Hideki", "evidence": [ { "database": "O-GlcNAc Database", "id": "P27515", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P27515" }, { "database": "O-GlcNAc Atlas", "id": "P27515", "url": "https://oglcnac.org/atlas/detail/P27515" } ], "reference": [ { "type": "PubMed", "id": "33229814", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "title": "Twelve open reading frames revealed in the 23.6 kb segment flanking the centromere on the Saccharomyces cerevisiae chromosome XIV right arm.", "journal": "Yeast", "date": "1994", "authors": "Verhasselt P., Volckaert G., Voet M., Aert R.", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "reference": [ { "type": "PubMed", "id": "7900425", "url": "https://glygen.org/publication/PubMed/7900425" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] } ], "pathway": [ { "id": "sce:YNR012W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNR012W", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q91YL3-1", "protein_name": "Uridine-cytidine kinase-like 1", "gene_name": "Uckl1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAPPASMSAAPSPLQSAVAPDVPGRQAEQNETACEDRSNAGTLDRLLPPVGTGRSPRKRTTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTQQQQEQAACNNFNFDHPDAFDFDLIISTLKKLKQGRSVQVPIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQLEERELSVRAALASAHQCHPLPQTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRLLIEHALSFLPFQDCTVQTPQGQDYVGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIGTILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSDDDEAATVG", "length": 548 }, "evidence": [ { "id": "P27515", "url": "https://omabrowser.org/oma/group/P27515/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NWZ5-1", "protein_name": "Uridine-cytidine kinase-like 1", "gene_name": "UCKL1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKRTTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPSFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQLEERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRLLIEHALSFLPFQDCVVQTPQGQDYAGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIGTILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSDEEEVAYTG", "length": 548 }, "evidence": [ { "id": "P27515", "url": "https://omabrowser.org/oma/group/P27515/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "pyrimidine-containing compound salvage", "id": "GO:0008655", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008655", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" }, { "name": "UMP salvage", "id": "GO:0044206", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044206", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" }, { "name": "CTP salvage", "id": "GO:0044211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044211", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" }, { "name": "uridine kinase activity", "id": "GO:0004849", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004849", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" }, { "name": "cytidine kinase activity", "id": "GO:0043771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043771", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P27515", "url": "https://www.uniprot.org/uniprot/P27515" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 244, "end_pos": 246, "annotation": "n_glycosylation_sequon" }, { "start_pos": 380, "end_pos": 382, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16825", "name": "", "equation": "ATP + uridine = ADP + H(+) + UMP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A8I5ZVU1-1", "Q9QYG8-1", "B5DF24-1", "Q9NWZ5-1", "Q9BZX2-1", "Q9HA47-1", "Q91YL3-1", "P52623-1", "Q99PM9-1", "P27515-1", "Q12084-1", "Q54R62-1", "Q8T154-1", "Q9GNF0-1", "Q55EL3-1", "Q9VC99-1", "Q8MQK4-1" ], "evidence": [ { "id": "16825", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16825" } ] }, { "id": "24674", "name": "", "equation": "ATP + cytidine = ADP + CMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A8I5ZVU1-1", "Q9QYG8-1", "B5DF24-1", "Q9NWZ5-1", "Q9BZX2-1", "Q9HA47-1", "Q91YL3-1", "P52623-1", "Q99PM9-1", "P27515-1", "Q12084-1", "Q54R62-1", "Q8T154-1", "Q9GNF0-1", "Q55EL3-1", "Q9VC99-1", "Q8MQK4-1" ], "evidence": [ { "id": "24674", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/24674" } ] }, { "id": "R-SCE-8954327", "name": "UCKL1 phosphorylates urindine, cytidine", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P27515-1" ], "evidence": [ { "id": "R-SCE-8954327", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-8954327" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A8I5ZVU1", "gene_name": "Uckl1", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "A0A8I5ZVU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZVU1" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "A0A8I5ZVU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZVU1" } ] } ] }, { "uniprot_ac": "B5DF24", "gene_name": "Uck1", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "B5DF24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DF24" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "B5DF24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DF24" } ] } ] }, { "uniprot_ac": "P27515", "gene_name": "URK1", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "P27515", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27515" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "P27515", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27515" } ] } ] }, { "uniprot_ac": "P52623", "gene_name": "Uck1", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "P52623", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52623" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "P52623", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52623" } ] } ] }, { "uniprot_ac": "Q12084", "gene_name": "DAS2", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q12084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12084" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q12084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12084" } ] } ] }, { "uniprot_ac": "Q54R62", "gene_name": "udkC", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q54R62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R62" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q54R62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R62" } ] } ] }, { "uniprot_ac": "Q55EL3", "gene_name": "udkA", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q55EL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EL3" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q55EL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EL3" } ] } ] }, { "uniprot_ac": "Q8MQK4", "gene_name": "l(2)k01209", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q8MQK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MQK4" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q8MQK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MQK4" } ] } ] }, { "uniprot_ac": "Q8T154", "gene_name": "udkB", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q8T154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T154" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q8T154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T154" } ] } ] }, { "uniprot_ac": "Q91YL3", "gene_name": "Uckl1", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q91YL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YL3" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q91YL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YL3" } ] } ] }, { "uniprot_ac": "Q99PM9", "gene_name": "Uck2", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q99PM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PM9" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q99PM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PM9" } ] } ] }, { "uniprot_ac": "Q9BZX2", "gene_name": "UCK2", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q9BZX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZX2" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q9BZX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZX2" } ] } ] }, { "uniprot_ac": "Q9GNF0", "gene_name": "udkD", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q9GNF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GNF0" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q9GNF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GNF0" } ] } ] }, { "uniprot_ac": "Q9HA47", "gene_name": "UCK1", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q9HA47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HA47" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q9HA47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HA47" } ] } ] }, { "uniprot_ac": "Q9NWZ5", "gene_name": "UCKL1", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q9NWZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWZ5" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q9NWZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWZ5" } ] } ] }, { "uniprot_ac": "Q9QYG8", "gene_name": "Uck2", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q9QYG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYG8" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q9QYG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYG8" } ] } ] }, { "uniprot_ac": "Q9VC99", "gene_name": "Uck", "activity": [ { "ec_number": "2.7.1.48", "activity": "cytidine + GTP = CMP + GDP + H(+).", "evidence": [ { "id": "Q9VC99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VC99" } ] }, { "ec_number": "2.7.1.48", "activity": "", "evidence": [ { "id": "Q9VC99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VC99" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }