{ "uniprot_canonical_ac": "P27364-1", "uniprot_ac": "P27364", "uniprot_id": "3BHS5_RAT", "mass": { "chemical_mass": 42206.0, "monoisotopic_mass": 42206.0 }, "refseq": { "ac": "NP_036716", "name": "NADPH-dependent 3-keto-steroid reductase Hsd3b5", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" }, "gene_names": [ { "name": "Hsd3b5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P27364", "id": "P27364" }, { "name": "Hsd1; Hsd3b; RATHSDI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716", "id": "NP_036716" }, { "name": "Hsd3b5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716", "id": "NP_036716" }, { "name": "Hsd3b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P27364", "id": "P27364" }, { "name": "LOC100911116", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P27364", "id": "P27364" } ], "protein_names": [ { "name": "NADPH-dependent 3-keto-steroid reductase Hsd3b5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P27364" }, { "name": "1.1.1.210", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27364" }, { "name": "1.1.1.270", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27364" }, { "name": "3 beta-HSD III", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27364" }, { "name": "3 beta-hydroxysteroid dehydrogenase 5; 3 beta-hydroxysteroid dehydrogenase type 5; 3 beta-hydroxysteroid dehydrogenase type 5-like; 3-beta-HSD V; progesterone reductase; 3 beta-hydroxysteroid dehydrogenase type V; 3-beta-hydroxy-5-ene steroid dehydrogenase; NADPH-dependent 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; steroid delta-isomerase, 3 beta; 3 beta-HSD III; dihydrotestosterone 3-ketoreductase; 3 beta-hydroxysteroid dehydrogenase type 3; 3 beta-hydroxysteroid dehydrogenase type III", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716", "id": "NP_036716" }, { "name": "3 beta-hydroxysteroid dehydrogenase type 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27364" }, { "name": "3 beta-hydroxysteroid dehydrogenase type III", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27364" }, { "name": "Dihydrotestosterone 3-ketoreductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P27364" }, { "name": "NADPH-dependent 3-keto-steroid reductase Hsd3b5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716", "id": "NP_036716" } ], "function": [ { "annotation": "ERalpha interaction with transcription coregulators, histone acetylases (CBP/SRC-1), and PGC-1alpha is crucial to FSH and TGFbeta1-up-regulated expression of Hsd3b and Cyp11a1, and, thus, progesterone production in rat ovarian granulosa cells.", "evidence": [ { "database": "RefSeq", "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" }, { "database": "PubMed", "id": "18511507", "url": "https://glygen.org/publication/PubMed/18511507" } ] }, { "annotation": "In ovariectomized-adrenalectomized rats, estrogen treatment increased 3beta-HSD mRNA in the hypothalamus.", "evidence": [ { "database": "RefSeq", "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" }, { "database": "PubMed", "id": "16020475", "url": "https://glygen.org/publication/PubMed/16020475" } ] }, { "annotation": "Responsible for the reduction of the oxo group on the C-3 of 5alpha-androstane steroids. Catalyzes the conversion of dihydrotestosterone to its inactive form 5alpha-androstanediol, that does not bind androgen receptor/AR. Also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. Does not function as an isomerase.", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364#function" }, { "database": "PubMed", "id": "1537836", "url": "https://glygen.org/publication/PubMed/1537836" } ] }, { "annotation": "Significant decrease in the 3beta-HSD mRNA expression in traumatic brain injury site within the frontal cortex in both males and pseudopregnant females.", "evidence": [ { "database": "RefSeq", "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" }, { "database": "PubMed", "id": "17428656", "url": "https://glygen.org/publication/PubMed/17428656" } ] }, { "annotation": "These steroidogenic enzymes within the Leydig cells, including steroidogenic acute regulatory protein (StAR), cholesterol side-chain cleavage cytochrome P450 (P450scc) and 3beta-hydroxysteroid dehydrogenase (3beta-HSD), were down-regulated.", "evidence": [ { "database": "RefSeq", "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" }, { "database": "PubMed", "id": "30884106", "url": "https://glygen.org/publication/PubMed/30884106" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:10892", "recommended_name": { "id": "DOID:10892", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10892", "name": "hypospadias", "description": "A physical disorder characterized by an abnormally placed urethral opening on the underside of the penis or on the perineum." }, "synonyms": [ { "id": "DOID:10892", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10892", "name": "familial hypospadias", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal, multifactorial", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "HYSP3", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "hypospadias 4, X-linked", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "HYSP4", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "hypospadias 4, X-linked, susceptibility to", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "HYSP2", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "HYSP1", "description": "" }, { "id": "MIM:300758", "resource": "MIM", "url": "https://www.omim.org/entry/300758", "name": "Hypospadias 2, X-linked", "description": "Hypospadias 2, X-linked" }, { "id": "MIM:300633", "resource": "MIM", "url": "https://www.omim.org/entry/300633", "name": "Hypospadias 1, X-linked", "description": "Hypospadias 1, X-linked" } ], "evidence": [ { "id": "10892", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10892" } ] }, { "disease_id": "DOID:11612", "recommended_name": { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "polycystic ovary syndrome", "description": "An ovarian dysfunction that is characterized by hyperandrogenism, polycystic ovaries, hirsutism, oligomenorrhea or amenorrhea, anovulation and excessive body weight." }, "synonyms": [ { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Multicystic ovaries", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "PCOS", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Polycystic Ovarian disease", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Polycystic ovaries", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Stein-Leventhal synd.", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Stein-Leventhal syndrome", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "polycystic ovary", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome", "description": "A disorder that manifests as multiple cysts on the ovaries. It results in hormonal imbalances and leads to irregular and abnormal menstrual periods, excess growth of hair, acne eruptions and obesity." }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCOS", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "Stein-Leventhal synd.", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "Stein-Leventhal syndrome", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "multicystic ovaries", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovarian disease", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovaries", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCOS1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome 1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCO1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "hyperandrogenemia", "description": "" } ], "evidence": [ { "id": "11612", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11612" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "common_name": "Rat" } ], "gene": [ { "name": "Hsd3b5", "url": "https://www.uniprot.org/uniprot/P27364", "locus": { "chromosome": "2", "start_pos": 186008943, "end_pos": 186020393, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000019417", "url": "https://www.ensembl.org/id/ENSRNOG00000019417" } ] } } ], "crossref": [ { "id": "ENSRNOG00000019417", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000019417", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "24470", "url": "https://www.ncbi.nlm.nih.gov/gene/24470", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:24470", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:24470", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "AWPNSYK", "url": "https://omabrowser.org/oma/group/AWPNSYK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3675908at2759", "url": "http://www.orthodb.org/?query=3675908at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10366", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10366", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10366:SF297", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10366:SF297", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01073", "url": "http://pfam.xfam.org/family/PF01073", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P27364", "url": "http://purl.obolibrary.org/obo/PR_P27364", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193048", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-193993", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193993", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-194002", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-194002", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2838", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2838", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "16297", "url": "https://www.rhea-db.org/rhea/16297", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "34787", "url": "https://www.rhea-db.org/rhea/34787", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56916", "url": "https://www.rhea-db.org/rhea/56916", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2JSR3", "url": "https://www.uniprot.org/uniprot/A0A0G2JSR3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JSR3-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JSR3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P27364-1", "url": "https://www.uniprot.org/uniprot/P27364-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQMLVQEKELQEVRVLYRTFSPKHKEELSKLQTKAKVTVLRGDIVDAQFLRRACQGMSVIIHTAAALDIAGFLPRQTILDVNVKGTQLLLDACVEASVPAFIYSSSTGVAGPNSYKETILNDREEEHRESTWSNPYPYSKRMAEKAVLAANGSILKNGGTFHTCALRLPFIYGEESQIISTMVNRALKNNSIIKRHATFSIANPVYVGNAAWAHILAARGLRDPEKSQSIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSSWSLPLPLLYWLAFLLETVSFLLRPFYNYRPPFNRFMVTILNSVFTISYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373, "header": "sp|P27364-1|3BHS5_RAT Isoform 1 of NADPH-dependent 3-keto-steroid reductase Hsd3b5 OS=Rattus norvegicus OX=10116 GN=Hsd3b5 PE=1 SV=3 CANONICAL=P27364-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JSR3-1", "url": "", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQMLVQEKELQEVRVLYRTFSPKHKEELSKLQTKAKVTVLRGDIVDAQFLRRACQGMSVIIHTAAALDIAGFLPRQTILDVNVKGTQLLLDACVEASVPAFIYSSSTGVAGPNSYKETILNDREEEHRESTWSNPYPYSKRMAEKAVLAANGSILKNGGTLHTCALRLPFIYGEESQIISTMVNTALKNNSIIKRHATFSIANPVYVGNAAWAHILAARGLRDPEKSQSIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSSWSLPLPLLYWLAFLLETVSFLLRPFYNYRPPFNRFMVTILNSVFTISYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373, "header": "tr|A0A0G2JSR3-1|3BHS5_RAT Computationally mapped isoform of NADPH-dependent 3-keto-steroid reductase Hsd3b5 OS=Rattus norvegicus OX=10116 GN=Hsd3b5 PE=1 SV=1 CANONICAL=P27364-1" }, "locus": { "chromosome": "2", "start_pos": 186020325, "end_pos": 186009710, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000079754.2", "url": "https://www.ensembl.org/id/ENSRNOT00000079754.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000072555.1", "url": "https://www.ensembl.org/id/ENSRNOP00000072555.1" } ] } }, { "isoform_ac": "P27364-1", "url": "", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQMLVQEKELQEVRVLYRTFSPKHKEELSKLQTKAKVTVLRGDIVDAQFLRRACQGMSVIIHTAAALDIAGFLPRQTILDVNVKGTQLLLDACVEASVPAFIYSSSTGVAGPNSYKETILNDREEEHRESTWSNPYPYSKRMAEKAVLAANGSILKNGGTFHTCALRLPFIYGEESQIISTMVNRALKNNSIIKRHATFSIANPVYVGNAAWAHILAARGLRDPEKSQSIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSSWSLPLPLLYWLAFLLETVSFLLRPFYNYRPPFNRFMVTILNSVFTISYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373, "header": "sp|P27364-1|3BHS5_RAT Isoform 1 of NADPH-dependent 3-keto-steroid reductase Hsd3b5 OS=Rattus norvegicus OX=10116 GN=Hsd3b5 PE=1 SV=3 CANONICAL=P27364-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Expression of liver-specific member of the 3 beta-hydroxysteroid dehydrogenase family, an isoform possessing an almost exclusive 3-ketosteroid reductase activity.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Labrie F., Simard J., de Launoit Y., Zhao H.F., Belanger A.", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "reference": [ { "type": "PubMed", "id": "1537836", "url": "https://glygen.org/publication/PubMed/1537836" } ] }, { "title": "Neurosteroids and female reproduction: estrogen increases 3beta-HSD mRNA and activity in rat hypothalamus.", "journal": "Endocrinology", "date": "2005", "authors": "Soma KK, Sinchak K, Lakhter A, Schlinger BA, Micevych PE", "evidence": [ { "database": "RefSeq", "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" } ], "reference": [ { "type": "PubMed", "id": "16020475", "url": "https://glygen.org/publication/PubMed/16020475" } ] }, { "title": "3beta-Hydroxysteroid dehydrogenase/5-ene-4-ene isomerase mRNA expression in rat brain: effect of pseudopregnancy and traumatic brain injury.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2007", "authors": "Meffre D, Delespierre B, Gouezou M, Schumacher M, Stein DG, Guennoun R", "evidence": [ { "database": "RefSeq", "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" } ], "reference": [ { "type": "PubMed", "id": "17428656", "url": "https://glygen.org/publication/PubMed/17428656" } ] }, { "title": "Crucial role of estrogen receptor-alpha interaction with transcription coregulators in follicle-stimulating hormone and transforming growth factor beta1 up-regulation of steroidogenesis in rat ovarian granulosa cells.", "journal": "Endocrinology", "date": "2008", "authors": "Chen YJ, Lee MT, Yao HC, Hsiao PW, Ke FC, Hwang JJ", "evidence": [ { "database": "RefSeq", "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" } ], "reference": [ { "type": "PubMed", "id": "18511507", "url": "https://glygen.org/publication/PubMed/18511507" } ] }, { "title": "Structure and sexual dimorphic expression of a liver-specific rat 3 beta-hydroxysteroid dehydrogenase/isomerase.", "journal": "Endocrinology", "date": "1990", "authors": "Zhao HF, Rheaume E, Trudel C, Couet J, Labrie F, Simard J", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "reference": [ { "type": "PubMed", "id": "2249649", "url": "https://glygen.org/publication/PubMed/2249649" } ] }, { "title": "HC diet inhibited testosterone synthesis by activating endoplasmic reticulum stress in testicular Leydig cells.", "journal": "Journal of cellular and molecular medicine", "date": "2019", "authors": "Yu C, Jiang F, Zhang M, Luo D, Shao S, Zhao J, Gao L, Zuo C, Guan Q", "evidence": [ { "database": "RefSeq", "id": "NP_036716", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036716" } ], "reference": [ { "type": "PubMed", "id": "30884106", "url": "https://glygen.org/publication/PubMed/30884106" } ] } ], "pathway": [ { "id": "rno:24470", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:24470", "resource": "KEGG Pathway" }, { "id": "R-RNO-193048", "name": "Androgen biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193048", "resource": "Reactome", "description": "Androgen biosynthesis" }, { "id": "R-RNO-193993", "name": "Mineralocorticoid biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193993", "resource": "Reactome", "description": "Mineralocorticoid biosynthesis" }, { "id": "R-RNO-194002", "name": "Glucocorticoid biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-194002", "resource": "Reactome", "description": "Glucocorticoid biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "E9Q007-1", "protein_name": "Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 9", "gene_name": "Hsd3b9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKQEEELSKLQTKAKVTALKGDILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEANVPTFIYSSSVLVAGPNSYKEIILNAHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRLSFIYGEECQVTSTTVKTALKNNSIIKKDATFSIANPVYVGNAAWAHILAARSLQDPKKSPSIQGQFYYITDDTPHQSYDDLKCTLSKEWGLRLDTSWSLPLPLLYWLAFLLETVSFLLRPVYNYRPPFNRLLITVLNSVFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVMQHREIGNKKSQ", "length": 373 }, "evidence": [ { "id": "45227310", "url": "http://www.informatics.jax.org/homology/45227310", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P14060-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1", "gene_name": "HSD3B1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ", "length": 373 }, "evidence": [ { "id": "45227309", "url": "http://www.informatics.jax.org/homology/45227309", "database": "MGI" }, { "id": "45227314", "url": "http://www.informatics.jax.org/homology/45227314", "database": "MGI" }, { "id": "45227316", "url": "http://www.informatics.jax.org/homology/45227316", "database": "MGI" }, { "id": "45227310", "url": "http://www.informatics.jax.org/homology/45227310", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P26439-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2", "gene_name": "HSD3B2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ", "length": 372 }, "evidence": [ { "id": "45227309", "url": "http://www.informatics.jax.org/homology/45227309", "database": "MGI" }, { "id": "45227314", "url": "http://www.informatics.jax.org/homology/45227314", "database": "MGI" }, { "id": "45227316", "url": "http://www.informatics.jax.org/homology/45227316", "database": "MGI" }, { "id": "45227310", "url": "http://www.informatics.jax.org/homology/45227310", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q61694-1", "protein_name": "NADPH-dependent 3-keto-steroid reductase Hsd3b5", "gene_name": "Hsd3b5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKHEEELSKLQTKAKVRVLKGDILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEASVPTFIYSSSVLVAGPNSYKEIILNAHEEEHRESTWPNPYPYSKRMAEKAVLATNGRLLKNGGTLHTCALRLPFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQDPKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLYWLAFLLETVSFLLRPVYNYRPPFNRLLITVLNSVFTISYKKAQRDLGYQPLVSWEEAKQKTSEWIGTLVKQHRETLHKKSQ", "length": 373 }, "evidence": [ { "id": "45227316", "url": "http://www.informatics.jax.org/homology/45227316", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q61767-1", "protein_name": "NADPH-dependent 3-keto-steroid reductase Hsd3b4", "gene_name": "Hsd3b4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKQEEELSKLQTKTKVTVLKGDILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEANVPTFIYSSSVLVAGPNSYKEIILNAHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRLSFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQDPKKSPSIQGQFYYITDDTPHQSYDDLKCTLSKEWGLRLDTSWSLPLPLLYWLAFLLETVSFLLRPVYNYRPPFNRLLITVLNSVFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVMQHREIGNKKSQ", "length": 373 }, "evidence": [ { "id": "45227309", "url": "http://www.informatics.jax.org/homology/45227309", "database": "MGI" }, { "id": "45227314", "url": "http://www.informatics.jax.org/homology/45227314", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "3-beta-hydroxy-delta5-steroid dehydrogenase activity", "id": "GO:0003854", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003854", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "steroid dehydrogenase activity", "id": "GO:0016229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016229", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "steroid binding", "id": "GO:0005496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005496", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor", "id": "GO:0016616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016616", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "3-keto sterol reductase activity", "id": "GO:0000253", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000253", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "5alpha-androstane-3beta,17beta-diol dehydrogenase activity", "id": "GO:0047024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047024", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "cycloeucalenone reductase activity", "id": "GO:0102176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102176", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "steroid biosynthetic process", "id": "GO:0006694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006694", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "hippocampus development", "id": "GO:0021766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021766", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "C21-steroid hormone metabolic process", "id": "GO:0008207", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008207", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "response to corticosterone", "id": "GO:0051412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051412", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "progesterone metabolic process", "id": "GO:0042448", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042448", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" }, { "name": "regulation of steroid biosynthetic process", "id": "GO:0050810", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050810", "evidence": [ { "database": "UniProtKB", "id": "P27364", "url": "https://www.uniprot.org/uniprot/P27364" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" }, { "start_pos": 208, "end_pos": 210, "annotation": "n_glycosylation_sequon" }, { "start_pos": 269, "end_pos": 271, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16297", "name": "", "equation": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22071-1", "P27364-1", "Q62904-1", "P14060-1", "P17516-1", "Q04828-1", "P42330-1", "P56937-1", "P24815-1", "Q61694-1", "Q61767-1", "O88736-1" ], "evidence": [ { "id": "16297", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16297" } ] }, { "id": "34787", "name": "", "equation": "a 3beta-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22071-1", "P27364-1", "Q62904-1", "P14060-1", "Q6UWP2-1", "P56937-1", "P24815-1", "Q61694-1", "Q61767-1", "O88736-1", "Q3U0B3-1" ], "evidence": [ { "id": "34787", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/34787" } ] }, { "id": "56916", "name": "", "equation": "3beta-hydroxy-5alpha-androstan-17-one + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22071-1", "P27364-1", "P14060-1", "P24815-1" ], "evidence": [ { "id": "56916", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56916" } ] }, { "id": "R-RNO-193052", "name": "Pregn-5-ene-3,20-dione isomerizes to progesterone", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22071-1", "P27364-1" ], "evidence": [ { "id": "R-RNO-193052", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193052" } ] }, { "id": "R-RNO-193073", "name": "HSD2B1 dimer, HSD3B2 dimer isomerise DHA to ANDST", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-193079" ], "enzyme_list": [ "P22071-1", "P27364-1" ], "evidence": [ { "id": "R-RNO-193073", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193073" } ] }, { "id": "R-RNO-193961", "name": "Pregn-5-ene-3,20-dione-17-ol isomerizes to 17-hydroxyprogesterone", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22071-1", "P27364-1" ], "evidence": [ { "id": "R-RNO-193961", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193961" } ] }, { "id": "R-RNO-196350", "name": "Pregnenolone is dehydrogenated to form pregn-5-ene-3,20-dione", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-196344" ], "enzyme_list": [ "P22071-1", "P27364-1" ], "evidence": [ { "id": "R-RNO-196350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-196350" } ] }, { "id": "R-RNO-196372", "name": "17-Hydroxypregnenolone is dehydrogenated to form pregn-5-ene-3,20-dione-17-ol", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-196366" ], "enzyme_list": [ "P22071-1", "P27364-1" ], "evidence": [ { "id": "R-RNO-196372", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-196372" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-193079", "participant_name": "ANDST [cytosol]", "crossref": [ { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-196344", "participant_name": "pregn-5-ene-3,20-dione [cytosol]", "crossref": [ { "id": "63837", "database": "ChEBI", "url": "" }, { "id": "000096085295", "database": "ZINC", "url": "" }, { "id": "HMDB0062521", "database": "HMDB Metabolite", "url": "" }, { "id": "63837", "database": "ChEBI", "url": "" }, { "id": "000096085295", "database": "ZINC", "url": "" }, { "id": "HMDB0062521", "database": "HMDB Metabolite", "url": "" }, { "id": "63837", "database": "ChEBI", "url": "" }, { "id": "000096085295", "database": "ZINC", "url": "" }, { "id": "HMDB0062521", "database": "HMDB Metabolite", "url": "" }, { "id": "63837", "database": "ChEBI", "url": "" }, { "id": "000096085295", "database": "ZINC", "url": "" }, { "id": "HMDB0062521", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-196366", "participant_name": "pregn-5-ene-3,20-dione-17-ol [cytosol]", "crossref": [ { "id": "63843", "database": "ChEBI", "url": "" }, { "id": "HMDB0062522", "database": "HMDB Metabolite", "url": "" }, { "id": "000096085296", "database": "ZINC", "url": "" }, { "id": "63843", "database": "ChEBI", "url": "" }, { "id": "000096085296", "database": "ZINC", "url": "" }, { "id": "HMDB0062522", "database": "HMDB Metabolite", "url": "" }, { "id": "63843", "database": "ChEBI", "url": "" }, { "id": "000096085296", "database": "ZINC", "url": "" }, { "id": "HMDB0062522", "database": "HMDB Metabolite", "url": "" }, { "id": "63843", "database": "ChEBI", "url": "" }, { "id": "000096085296", "database": "ZINC", "url": "" }, { "id": "HMDB0062522", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O88736", "gene_name": "Hsd17b7", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "O88736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88736" } ] }, { "ec_number": "1.1.1.270", "activity": "", "evidence": [ { "id": "O88736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88736" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "O88736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88736" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "O88736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88736" } ] } ] }, { "uniprot_ac": "P14060", "gene_name": "HSD3B1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] } ] }, { "uniprot_ac": "P17516", "gene_name": "AKR1C4", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.225", "activity": "chlordecone alcohol + NADP(+) = chlordecone + H(+) + NADPH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.357", "activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.209", "activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.51", "activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.53", "activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.62", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.209", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.53", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.51", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.210", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] } ] }, { "uniprot_ac": "P22071", "gene_name": "Hsd3b1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] } ] }, { "uniprot_ac": "P24815", "gene_name": "Hsd3b1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] } ] }, { "uniprot_ac": "P27364", "gene_name": "Hsd3b5", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P27364", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27364" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P27364", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27364" } ] } ] }, { "uniprot_ac": "P42330", "gene_name": "AKR1C3", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.357", "activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.188", "activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin D2.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.239", "activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.64", "activity": "NADP(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.53", "activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.210", "activity": "", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.53", "activity": "", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.62", "activity": "", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] } ] }, { "uniprot_ac": "P56937", "gene_name": "HSD17B7", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P56937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56937" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "P56937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56937" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P56937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56937" } ] } ] }, { "uniprot_ac": "Q04828", "gene_name": "AKR1C1", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.357", "activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.112", "activity": "(S)-indan-1-ol + NAD(+) = H(+) + indan-1-one + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.149", "activity": "(17R,20S)-17,20-dihydroxypregn-4-en-3-one + NAD(+) = 17alpha-hydroxyprogesterone + H(+) + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.3.1.20", "activity": "(1R,2R)-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + H(+) + NADPH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.209", "activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.51", "activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.53", "activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.210", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.112", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.357", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.51", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.3.1.20", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.53", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.62", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.209", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] } ] }, { "uniprot_ac": "Q3U0B3", "gene_name": "Dhrs11", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q3U0B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U0B3" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "Q3U0B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U0B3" } ] } ] }, { "uniprot_ac": "Q61694", "gene_name": "Hsd3b5", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q61694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61694" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q61694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61694" } ] } ] }, { "uniprot_ac": "Q61767", "gene_name": "Hsd3b4", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q61767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61767" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q61767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61767" } ] } ] }, { "uniprot_ac": "Q62904", "gene_name": "Hsd17b7", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q62904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62904" } ] }, { "ec_number": "1.1.1.270", "activity": "", "evidence": [ { "id": "Q62904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62904" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "Q62904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62904" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q62904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62904" } ] } ] }, { "uniprot_ac": "Q6UWP2", "gene_name": "DHRS11", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q6UWP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWP2" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "Q6UWP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWP2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }