{ "uniprot_canonical_ac": "P26725-1", "uniprot_ac": "P26725", "uniprot_id": "YUR1_YEAST", "mass": { "chemical_mass": 50836.0, "monoisotopic_mass": 50836.0 }, "refseq": { "ac": "NP_012396", "name": "mannosyltransferase YUR1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012396" }, "gene_names": [ { "name": "YUR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P26725", "id": "P26725" }, { "name": "J0657", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P26725", "id": "P26725" }, { "name": "YUR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012396", "id": "NP_012396" } ], "protein_names": [ { "name": "Probable mannosyltransferase YUR1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P26725" }, { "name": "2.4.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P26725" }, { "name": "mannosyltransferase YUR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012396", "id": "NP_012396" } ], "function": [ { "annotation": "Possible glycosyltransferase involved in N-linked glycosylation. Transfers an alpha-D-mannosyl residue from GDP-mannose into lipid-linked oligosaccharide, forming an alpha-(1->2)-D-mannosyl-D-mannose linkage.", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "common_name": "Yeast" } ], "gene": [ { "name": "YUR1", "url": "https://www.uniprot.org/uniprot/P26725", "locus": {} } ], "crossref": [ { "id": "GT15", "url": "http://www.cazy.org/GT15.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "853302", "url": "https://www.ncbi.nlm.nih.gov/gene/853302", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P26725", "url": "https://www.ebi.ac.uk/intact/interactors/id:P26725*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002685", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002685", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YJL139C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YJL139C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DWYFRVE", "url": "https://omabrowser.org/oma/group/DWYFRVE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1981584at2759", "url": "http://www.orthodb.org/?query=1981584at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31121", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31121", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31121:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31121:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01793", "url": "http://pfam.xfam.org/family/PF01793", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P26725", "url": "http://purl.obolibrary.org/obo/PR_P26725", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012396", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012396", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000003675", "url": "https://www.yeastgenome.org/locus/S000003675", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P26725-1", "url": "https://www.uniprot.org/uniprot/P26725-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKGGSLYIVGIFLPIWTFMIYIFGKELFLIRKYQKIDSTYTALSQRVKEQYDTSRRRNYFPKVKLSRNSYDDYTLNYTRQNDSDSFHLRENATILMLVRNSELEGALDSMRSLEDRFNNKYHYDWTFLNDVPFDQDFIEATTSMASGKTQYALIPPEDWNRPQWINDTLFEERLRVMEDEGVLYGGSKSYRNMCRFNSGFFFRQSILDNYDYYFRVEPNVKYYCDFPYDPFRVMRLKGKKYGFVISLYEYEETIPTLWDAVEEYLVASEETILRKEDSAYAFLTDSGLVGKHYPVVEANSDYNLCHFWSNFEIGDLNFFRSDEYKHFFETLDAKGGFYYERWGDAPVHSIGVSLLLRPDEIIHFDELGYFHSPFGTCPASYAVRLDQRCRCKSDDESVIDITPHSCLMRWWKNGSGKYFLKEEQDEI", "length": 428, "header": "sp|P26725-1|YUR1_YEAST Isoform 1 of Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=YUR1 PE=1 SV=1 CANONICAL=P26725-1" }, "isoforms": [ { "isoform_ac": "P26725-1", "url": "", "sequence": { "sequence": "MAKGGSLYIVGIFLPIWTFMIYIFGKELFLIRKYQKIDSTYTALSQRVKEQYDTSRRRNYFPKVKLSRNSYDDYTLNYTRQNDSDSFHLRENATILMLVRNSELEGALDSMRSLEDRFNNKYHYDWTFLNDVPFDQDFIEATTSMASGKTQYALIPPEDWNRPQWINDTLFEERLRVMEDEGVLYGGSKSYRNMCRFNSGFFFRQSILDNYDYYFRVEPNVKYYCDFPYDPFRVMRLKGKKYGFVISLYEYEETIPTLWDAVEEYLVASEETILRKEDSAYAFLTDSGLVGKHYPVVEANSDYNLCHFWSNFEIGDLNFFRSDEYKHFFETLDAKGGFYYERWGDAPVHSIGVSLLLRPDEIIHFDELGYFHSPFGTCPASYAVRLDQRCRCKSDDESVIDITPHSCLMRWWKNGSGKYFLKEEQDEI", "length": 428, "header": "sp|P26725-1|YUR1_YEAST Isoform 1 of Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=YUR1 PE=1 SV=1 CANONICAL=P26725-1" }, "locus": { "chromosome": "X", "start_pos": 152999, "end_pos": 151716, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YJL139C_mRNA", "url": "https://www.ensembl.org/id/YJL139C_mRNA" }, { "database": "Ensembl Peptide", "id": "YJL139C", "url": "https://www.ensembl.org/id/YJL139C" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 167, "start_aa": "Asn", "end_pos": 167, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn167", "evidence": [ { "id": "P26725", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26725#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 414, "start_aa": "Asn", "end_pos": 414, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn414", "evidence": [ { "id": "P26725", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26725#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 77, "start_aa": "Asn", "end_pos": 77, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn77", "evidence": [ { "id": "P26725", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26725#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 82, "start_aa": "Asn", "end_pos": 82, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn82", "evidence": [ { "id": "P26725", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26725#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P26725", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26725#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The Saccharomyces cerevisiae RPB4 gene is tightly linked to the TIF2 gene.", "journal": "Nucleic Acids Res.", "date": "1991", "authors": "Davis R.W., Sachs A.B., Foreman P.K.", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "reference": [ { "type": "PubMed", "id": "2041753", "url": "https://glygen.org/publication/PubMed/2041753" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X.", "journal": "EMBO J.", "date": "1996", "authors": "Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Pujol A., Galibert F., Rose M., Boles E., Durand P., Portetelle D., Zagulski M., Kleine K., Manus V., Rossau R., Cziepluch C., Jauniaux J.-C., Soriano N., Chuat J.-C., Koetter P., Entian K.-D., Kordes E., Louis E.J., Hollenberg C.P., Vandenbol M., Domdey H., Pohl T.M., Scarcez T., Goffeau A., Grivell L.A., Herbert C.J., Hilger F., Jacq C., Miosga T., Perea J., Schaaff-Gerstenschlaeger I., Zollner A., Alexandraki D., Huang M.-E., Kirchrath L., Purnelle B., Ramezani Rad M., Tzermia M., Baur A., Chalwatzis N., Coster F., Gatius M., Hennemann A., Heumann K., Karpfinger-Hartl L., Katsoulou C., Liebl S., Rasmussen S.W., Smits P.H.M., To Van D., Van Broekhoven A., de Haan M., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "reference": [ { "type": "PubMed", "id": "8641269", "url": "https://glygen.org/publication/PubMed/8641269" } ] }, { "title": "Sequence analysis of a 40.7 kb segment from the left arm of yeast chromosome X reveals 14 known genes and 13 new open reading frames including homologues of genes clustered on the right arm of chromosome XI.", "journal": "Yeast", "date": "1996", "authors": "Tavernarakis N., Alexandraki D., Tzermia M., Katsoulou C.", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "reference": [ { "type": "PubMed", "id": "8813765", "url": "https://glygen.org/publication/PubMed/8813765" } ] } ], "pathway": [ { "id": "sce:YJL139C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YJL139C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "cell wall mannoprotein biosynthetic process", "id": "GO:0000032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000032", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "pmid": "" }, { "name": "protein N-linked glycosylation", "id": "GO:0006487", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006487", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "pmid": "" }, { "name": "mannosylation", "id": "GO:0097502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097502", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "alpha-1,2-mannosyltransferase activity", "id": "GO:0000026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000026", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "pmid": "" }, { "name": "mannosyltransferase activity", "id": "GO:0000030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000030", "evidence": [ { "database": "UniProtKB", "id": "P26725", "url": "https://www.uniprot.org/uniprot/P26725" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 167, "end_pos": 169, "annotation": "n_glycosylation_sequon" }, { "start_pos": 414, "end_pos": 416, "annotation": "n_glycosylation_sequon" }, { "start_pos": 77, "end_pos": 79, "annotation": "n_glycosylation_sequon" }, { "start_pos": 82, "end_pos": 84, "annotation": "n_glycosylation_sequon" }, { "start_pos": 92, "end_pos": 94, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }