{ "uniprot_canonical_ac": "P26369-1", "uniprot_ac": "P26369", "uniprot_id": "U2AF2_MOUSE", "mass": { "chemical_mass": 53517.0, "monoisotopic_mass": 53517.0 }, "refseq": { "ac": "NP_598432", "name": "splicing factor U2AF 65 kDa subunit isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598432" }, "gene_names": [ { "name": "U2af2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P26369", "id": "P26369" }, { "name": "65kDa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192160", "id": "NP_001192160" }, { "name": "U2af2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192160", "id": "NP_001192160" }, { "name": "U2af65", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P26369", "id": "P26369" } ], "protein_names": [ { "name": "Splicing factor U2AF 65 kDa subunit", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P26369" }, { "name": "U2 auxiliary factor 65 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P26369" }, { "name": "U2 snRNP auxiliary factor large subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P26369" }, { "name": "splicing factor U2AF 65 kDa subunit isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192160", "id": "NP_001192160" }, { "name": "splicing factor U2AF 65 kDa subunit isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598432", "id": "NP_598432" }, { "name": "splicing factor U2AF 65 kDa subunit; U2 auxiliary factor 65 kDa subunit; U2 snRNP auxiliary factor large subunit; U2 small nuclear ribonucleoprotein auxiliary factor (U2AF), 65 kDa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598432", "id": "NP_598432" } ], "function": [ { "annotation": "Dephosphorylation of pS776-ATXN1 by PP2A regulates the interaction of ATXN1 with the splicing factors RBM17 and U2AF65 Erratum:[J Biol Chem. 2013 Mar 1;288(9):6590]", "evidence": [ { "database": "RefSeq", "id": "NP_598432", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598432" }, { "database": "PubMed", "id": "21835928", "url": "https://glygen.org/publication/PubMed/21835928" }, { "database": "RefSeq", "id": "NP_001192160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192160" } ] }, { "annotation": "Necessary for the splicing of pre-mRNA.", "evidence": [ { "database": "UniProtKB", "id": "Q80XR5", "url": "https://www.uniprot.org/uniprot/Q80XR5#function" }, { "database": "UniProtKB", "id": "RU364135", "url": "https://www.uniprot.org/uniprot/RU364135#function" }, { "database": "UniProtKB", "id": "Q3KQM4", "url": "https://www.uniprot.org/uniprot/Q3KQM4#function" } ] }, { "annotation": "Plays a role in pre-mRNA splicing and 3'-end processing. By recruiting PRPF19 and the PRP19C/Prp19 complex/NTC/Nineteen complex to the RNA polymerase II C-terminal domain (CTD), and thereby pre-mRNA, may couple transcription to splicing. Required for the export of mRNA out of the nucleus, even if the mRNA is encoded by an intron-less gene. Positively regulates pre-mRNA 3'-end processing by recruiting the CFIm complex to cleavage and polyadenylation signals.", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369#function" }, { "database": "UniProtKB", "id": "P26368", "url": "https://www.uniprot.org/uniprot/P26368#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "common_name": "Mouse" } ], "gene": [ { "name": "U2af2", "url": "https://www.uniprot.org/uniprot/P26369", "locus": { "chromosome": "7", "start_pos": 5082937, "end_pos": 5065142, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000030435", "url": "https://www.ensembl.org/id/ENSMUSG00000030435" } ] } } ], "crossref": [ { "id": "ENSMUSG00000030435", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000030435", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12230", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12230", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12231", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12231", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12232", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12232", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "22185", "url": "https://www.ncbi.nlm.nih.gov/gene/22185", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P26369", "url": "https://www.ebi.ac.uk/intact/interactors/id:P26369*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006529", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006529", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:22185", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22185", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "98886", "url": "http://www.informatics.jax.org/marker/MGI:98886", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P26369", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P26369", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MTQWDIK", "url": "https://omabrowser.org/oma/group/MTQWDIK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "101932at2759", "url": "http://www.orthodb.org/?query=101932at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23139", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23139", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23139:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23139:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2M52", "url": "https://www.rcsb.org/structure/2M52", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3V4M", "url": "https://www.rcsb.org/structure/3V4M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4RU2", "url": "https://www.rcsb.org/structure/4RU2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z2X", "url": "https://www.rcsb.org/structure/4Z2X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CXT", "url": "https://www.rcsb.org/structure/5CXT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P26369", "url": "http://purl.obolibrary.org/obo/PR_P26369", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-159236", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-72163", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-72187", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-72187", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-73856", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-73856", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9629569", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9629569", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001192160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192160", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A140LJ08", "url": "https://www.uniprot.org/uniprot/A0A140LJ08", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJ08-1", "url": "https://www.uniprot.org/uniprot/A0A140LJ08-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJK3", "url": "https://www.uniprot.org/uniprot/A0A140LJK3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJK3-1", "url": "https://www.uniprot.org/uniprot/A0A140LJK3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P26369-1", "url": "https://www.uniprot.org/uniprot/P26369-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3KQM4", "url": "https://www.uniprot.org/uniprot/Q3KQM4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3KQM4-1", "url": "https://www.uniprot.org/uniprot/Q3KQM4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80XR5", "url": "https://www.uniprot.org/uniprot/Q80XR5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80XR5-1", "url": "https://www.uniprot.org/uniprot/Q80XR5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSLPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW", "length": 475, "header": "sp|P26369-1|U2AF2_MOUSE Isoform 1 of Splicing factor U2AF 65 kDa subunit OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=3 CANONICAL=P26369-1" }, "isoforms": [ { "isoform_ac": "A0A140LJ08-1", "url": "", "sequence": { "sequence": "MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSTGEEAHLPVSLLRPRPSSPSWREWSLCVGGCGGLGGVPLWDLEAQCWSD", "length": 111, "header": "tr|A0A140LJ08-1|A0A140LJ08_MOUSE Computationally mapped isoform of U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=1 CANONICAL=P26369-1" }, "locus": { "chromosome": "7", "start_pos": 5070500, "end_pos": 5065287, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000207097.2", "url": "https://www.ensembl.org/id/ENSMUST00000207097.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147032.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147032.2" } ] } }, { "isoform_ac": "A0A140LJK3-1", "url": "", "sequence": { "sequence": "XAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITE", "length": 95, "header": "tr|A0A140LJK3-1|A0A140LJK3_MOUSE Computationally mapped isoform of U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=1 CANONICAL=P26369-1" }, "locus": { "chromosome": "7", "start_pos": 5071182, "end_pos": 5070227, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000207498.2", "url": "https://www.ensembl.org/id/ENSMUST00000207498.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147246.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147246.2" } ] } }, { "isoform_ac": "P26369-1", "url": "", "sequence": { "sequence": "MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSLPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW", "length": 475, "header": "sp|P26369-1|U2AF2_MOUSE Isoform 1 of Splicing factor U2AF 65 kDa subunit OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=3 CANONICAL=P26369-1" }, "locus": { "chromosome": "7", "start_pos": 5082312, "end_pos": 5065287, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000209099", "url": "https://www.ensembl.org/id/ENSMUST00000209099" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147013", "url": "https://www.ensembl.org/id/ENSMUSP00000147013" } ] } }, { "isoform_ac": "Q3KQM4-1", "url": "", "sequence": { "sequence": "MMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW", "length": 307, "header": "tr|Q3KQM4-1|Q3KQM4_MOUSE Computationally mapped isoform of Splicing factor U2AF subunit OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=1 CANONICAL=P26369-1" }, "locus": { "chromosome": "7", "start_pos": 5082312, "end_pos": 5072449, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000165399.2", "url": "https://www.ensembl.org/id/ENSMUST00000165399.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000131458.2", "url": "https://www.ensembl.org/id/ENSMUSP00000131458.2" } ] } }, { "isoform_ac": "Q80XR5-1", "url": "", "sequence": { "sequence": "MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW", "length": 471, "header": "tr|Q80XR5-1|Q80XR5_MOUSE Computationally mapped isoform of Splicing factor U2AF subunit OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=1 CANONICAL=P26369-1" }, "locus": { "chromosome": "7", "start_pos": 5082312, "end_pos": 5065287, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000005041.15", "url": "https://www.ensembl.org/id/ENSMUST00000005041.15" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000005041.9", "url": "https://www.ensembl.org/id/ENSMUSP00000005041.9" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P26369", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P26369" }, { "id": "34887587", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34887587" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] } ], "phosphorylation": [ { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "site_lbl": "Ser294" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "site_lbl": "Ser2" }, { "start_pos": 79, "end_pos": 79, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P26369", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P26369" } ], "site_lbl": "Ser79" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Cloning and sequencing of the murine homologue of the human splicing factor U2AF65.", "journal": "Nucleic Acids Res.", "date": "1992", "authors": "Sailer A, MacDonald NJ, Weissmann C", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "reference": [ { "type": "PubMed", "id": "1594454", "url": "https://glygen.org/publication/PubMed/1594454" } ] }, { "title": "Auxiliary splice factor U2AF26 and transcription factor Gfi1 cooperate directly in regulating CD45 alternative splicing.", "journal": "Nat. Immunol.", "date": "2006", "authors": "Heyd F, ten Dam G, Moroy T", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "reference": [ { "type": "PubMed", "id": "16819553", "url": "https://glygen.org/publication/PubMed/16819553" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" }, { "database": "iPTMnet", "id": "P26369", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P26369" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "14-3-3 Binding to ataxin-1(ATXN1) regulates its dephosphorylation at Ser-776 and transport to the nucleus.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lai S, O'Callaghan B, Zoghbi HY, Orr HT", "evidence": [ { "database": "RefSeq", "id": "NP_598432", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598432" }, { "database": "RefSeq", "id": "NP_001192160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192160" } ], "reference": [ { "type": "PubMed", "id": "21835928", "url": "https://glygen.org/publication/PubMed/21835928" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" }, { "database": "UniProtKB", "id": "Q80XR5", "url": "https://www.uniprot.org/uniprot/Q80XR5" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "O-GlcNAcylation is required for B cell homeostasis and antibody responses.", "journal": "Nature communications", "date": "2017", "authors": "Wu JL, Chiang MF, Hsu PH, Tsai DY, Hung KH, Wang YH, Angata T, Lin KI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P26369", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P26369" } ], "reference": [ { "type": "PubMed", "id": "29187734", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "title": "Dynamic eIF3a O-GlcNAcylation controls translation reinitiation during nutrient stress.", "journal": "Nature chemical biology", "date": "2022", "authors": "Shu XE, Mao Y, Jia L, Qian SB", "evidence": [ { "database": "O-GlcNAc Database", "id": "P26369", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P26369" } ], "reference": [ { "type": "PubMed", "id": "34887587", "url": "https://glygen.org/publication/PubMed/34887587" } ] } ], "pathway": [ { "id": "mmu:22185", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22185", "resource": "KEGG Pathway" }, { "id": "R-MMU-159236", "name": "Transport of Mature mRNA derived from an Intron-Containing Transcript", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-159236", "resource": "Reactome", "description": "Transport of Mature mRNA derived from an Intron-Containing Transcript" }, { "id": "R-MMU-72163", "name": "mRNA Splicing - Major Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-72163", "resource": "Reactome", "description": "mRNA Splicing - Major Pathway" }, { "id": "R-MMU-72187", "name": "mRNA 3'-end processing", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-72187", "resource": "Reactome", "description": "mRNA 3'-end processing" }, { "id": "R-MMU-73856", "name": "RNA Polymerase II Transcription Termination", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-73856", "resource": "Reactome", "description": "RNA Polymerase II Transcription Termination" }, { "id": "R-MMU-9629569", "name": "Protein hydroxylation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9629569", "resource": "Reactome", "description": "Protein hydroxylation" } ], "orthologs": [ { "uniprot_canonical_ac": "P26368-1", "protein_name": "Splicing factor U2AF 65 kDa subunit", "gene_name": "U2AF2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW", "length": 475 }, "evidence": [ { "id": "45232321", "url": "http://www.informatics.jax.org/homology/45232321", "database": "MGI" }, { "id": "P26369", "url": "https://omabrowser.org/oma/group/P26369/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "positive regulation of RNA splicing", "id": "GO:0033120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033120", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "RNA splicing", "id": "GO:0008380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008380", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "negative regulation of mRNA splicing, via spliceosome", "id": "GO:0048025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048025", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "negative regulation of protein ubiquitination", "id": "GO:0031397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "mRNA splicing, via spliceosome", "id": "GO:0000398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000398", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "mRNA processing", "id": "GO:0006397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006397", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "nuclear speck", "id": "GO:0016607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016607", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "spliceosomal complex", "id": "GO:0005681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005681", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "commitment complex", "id": "GO:0000243", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000243", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "U2-type prespliceosome", "id": "GO:0071004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071004", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "U2AF complex", "id": "GO:0089701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0089701", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "Prp19 complex", "id": "GO:0000974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000974", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "pre-mRNA 3'-splice site binding", "id": "GO:0030628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030628", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "poly-pyrimidine tract binding", "id": "GO:0008187", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008187", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "C2H2 zinc finger domain binding", "id": "GO:0070742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070742", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "molecular function inhibitor activity", "id": "GO:0140678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140678", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P26369", "url": "https://www.uniprot.org/uniprot/P26369" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 311, "end_pos": 313, "annotation": "n_glycosylation_sequon" }, { "start_pos": 341, "end_pos": 343, "annotation": "n_glycosylation_sequon" }, { "start_pos": 352, "end_pos": 354, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }