{ "uniprot_canonical_ac": "P26364-1", "uniprot_ac": "P26364", "uniprot_id": "KAD3_YEAST", "mass": { "chemical_mass": 25194.0, "monoisotopic_mass": 25194.0 }, "refseq": { "ac": "NP_011097", "name": "adenylate kinase ADK2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011097" }, "gene_names": [ { "name": "ADK2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P26364", "id": "P26364" }, { "name": "ADK2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011097", "id": "NP_011097" }, { "name": "AKY3; PAK3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011097", "id": "NP_011097" }, { "name": "AKY3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P26364", "id": "P26364" }, { "name": "PAK3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P26364", "id": "P26364" } ], "protein_names": [ { "name": "GTP:AMP phosphotransferase, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P26364" }, { "name": "2.7.4.10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P26364" }, { "name": "AK 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P26364" }, { "name": "Adenylate kinase 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P26364" }, { "name": "adenylate kinase ADK2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011097", "id": "NP_011097" } ], "function": [ { "annotation": "Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities. Does not accept ATP as phosphate donor.", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364#function" }, { "database": "UniProtKB", "id": "MF_03169", "url": "https://www.uniprot.org/uniprot/MF_03169#function" }, { "database": "PubMed", "id": "15753074", "url": "https://glygen.org/publication/PubMed/15753074" }, { "database": "PubMed", "id": "8537371", "url": "https://glygen.org/publication/PubMed/8537371" } ] } ], "disease": [ { "disease_id": "DOID:1040", "recommended_name": { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "chronic lymphocytic leukemia", "description": "A lymphocytic leukemia characterized by over production of B-cells and their accumulation in bone marrow and blood." }, "synonyms": [ { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "B-cell chronic lymphocytic leukaemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "B-cell chronic lymphocytic leukemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "CLL", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "chronic lymphatic leukaemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "chronic lymphatic leukemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "chronic lymphocytic leukaemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "lymphoplasmacytic leukaemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "lymphoplasmacytic leukemia", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "leukemia, chronic lymphocytic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "leukemia, chronic lymphocytic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "leukemia, chronic lymphocytic, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "B-cell malignancy, low-grade", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "Clls2", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "disrupted in B-cell malignancy", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "leukemia, chronic lymphocytic, B-cell", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphocytic leukemia", "description": "B-cell chronic lymphocytic leukemia (B-CLL) is a type of B-cell non-Hodgkin lymphoma, and the most common form of leukemia in Western countries, affecting elderly adults (mean age of 67 and 72 years) with a slight male predominance (1.7:1), and characterized by a highly variable clinical presentation that can include asymptomatic disease or non-specific B-symptoms such as unintentional weight loss, severe fatigue, fever (without evidence of infection), and night sweats as well as cervical lymphadenopathy, splenomegaly and frequent infections. Some patients can also develop autoimmune complications such as autoimmune hemolytic anemia or immune thrombocytopenia. The clinical course is extremely heterogeneous with survival ranging from a few months to several decades." }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell CLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell chronic lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell chronic lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-CLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell CLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphogenous leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphogenous leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphoid leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphoid leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "BCLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "CLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic B-cell lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic B-cell lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphatic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphatic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphocytic leukaemia (CLL)", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphocytic leukemia (CLL)", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphogenous leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphogenous leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "hematopoeitic - chronic lymphocytic leukaemia (CLL)", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "hematopoeitic - chronic lymphocytic leukemia (CLL)", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "lymphoplasmacytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "lymphoplasmacytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "leukemia, chronic LYMPHOCYTIC", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "leukemia, chronic lymphatic", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "leukemia, lymphocytic, chronic", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "small lymphocytic lymphoma", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "leukemia, chronic lymphocytic, susceptibility to, 5", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "leukemia, chronic lymphocytic susceptibility to, 5", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "leukemia, chronic lymphocytic, susceptibility to, 5", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "leukemia, chronic lymphocytic, susceptibility to, type 5", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "Clls5", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "leukemia, chronic lymphocytic, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "leukemia, chronic lymphocytic susceptibility to, 4", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "leukemia, chronic lymphocytic, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "leukemia, chronic lymphocytic, susceptibility to, type 4", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "Clls4", "description": "" }, { "id": "MONDO:0012934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012934", "name": "leukemia, chronic lymphocytic, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012934", "name": "leukemia, chronic lymphocytic, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012934", "name": "leukemia, chronic lymphocytic, susceptibility to, type 3", "description": "" }, { "id": "MONDO:0012934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012934", "name": "Clls3", "description": "" }, { "id": "MONDO:0012318", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012318", "name": "leukemia, chronic lymphocytic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0012318", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012318", "name": "leukemia, chronic lymphocytic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0012318", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012318", "name": "leukemia, chronic lymphocytic, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0012318", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012318", "name": "Clls1", "description": "" }, { "id": "MIM:151400", "resource": "MIM", "url": "https://www.omim.org/entry/151400", "name": "Leukemia, chronic lymphocytic", "description": "Leukemia, chronic lymphocytic" } ], "evidence": [ { "id": "1040", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1040" } ] }, { "disease_id": "DOID:12556", "recommended_name": { "id": "DOID:12556", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12556", "name": "acute kidney tubular necrosis", "description": "An acute kidney failure that is characterized by necrosis of epithelial tubule cells." }, "synonyms": [ { "id": "DOID:12556", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12556", "name": "ATN - acute tubular necrosis", "description": "" }, { "id": "DOID:12556", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12556", "name": "acute renal Failure with tubular necrosis", "description": "" }, { "id": "DOID:12556", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12556", "name": "acute tubular necrosis", "description": "" }, { "id": "DOID:12556", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12556", "name": "acute tubule necrosis", "description": "" }, { "id": "DOID:12556", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12556", "name": "acute renal failure with lesion of tubular necrosis", "description": "" } ], "evidence": [ { "id": "12556", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12556" } ] }, { "disease_id": "DOID:684", "recommended_name": { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "hepatocellular carcinoma", "description": "A liver carcinoma that has_material_basis_in undifferentiated hepatocytes and located_in the liver." }, "synonyms": [ { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "Hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MIM:114550", "resource": "MIM", "url": "https://www.omim.org/entry/114550", "name": "Hepatocellular carcinoma", "description": "Hepatocellular carcinoma" } ], "evidence": [ { "id": "684", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:684" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "common_name": "Yeast" } ], "gene": [ { "name": "ADK2", "url": "https://www.uniprot.org/uniprot/P26364", "locus": { "chromosome": "V", "start_pos": 526651, "end_pos": 525974, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YER170W", "url": "https://www.ensembl.org/id/YER170W" } ] } } ], "crossref": [ { "id": "cd01428", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01428", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "856917", "url": "https://www.ncbi.nlm.nih.gov/gene/856917", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P26364", "url": "https://www.ebi.ac.uk/intact/interactors/id:P26364*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007862", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007862", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028586", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028586", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033690", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033690", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YER170W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YER170W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IKVENTM", "url": "https://omabrowser.org/oma/group/IKVENTM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "167111at2759", "url": "http://www.orthodb.org/?query=167111at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23359", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23359", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23359:SF242", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23359:SF242", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00406", "url": "http://pfam.xfam.org/family/PF00406", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF05191", "url": "http://pfam.xfam.org/family/PF05191", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P26364", "url": "http://purl.obolibrary.org/obo/PR_P26364", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_011097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011097", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000000972", "url": "https://www.yeastgenome.org/locus/S000000972", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P26364-1", "url": "https://www.uniprot.org/uniprot/P26364-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKADAKQITHLLKPLRLLLLGAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTVSGETSDIIFRNY", "length": 225, "header": "sp|P26364-1|KAD3_YEAST Isoform 1 of GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae S288C OX=559292 GN=ADK2 PE=1 SV=1 CANONICAL=P26364-1" }, "isoforms": [ { "isoform_ac": "P26364-1", "url": "", "sequence": { "sequence": "MKADAKQITHLLKPLRLLLLGAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTVSGETSDIIFRNY", "length": 225, "header": "sp|P26364-1|KAD3_YEAST Isoform 1 of GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae S288C OX=559292 GN=ADK2 PE=1 SV=1 CANONICAL=P26364-1" }, "locus": { "chromosome": "V", "start_pos": 526648, "end_pos": 525974, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YER170W_mRNA", "url": "https://www.ensembl.org/id/YER170W_mRNA" }, { "database": "Ensembl Peptide", "id": "YER170W", "url": "https://www.ensembl.org/id/YER170W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "A GTP:AMP phosphotransferase, Adk2p, in Saccharomyces cerevisiae. Role of the C terminus in protein folding/stabilization, thermal tolerance, and enzymatic activity.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Gu Y., Gordon D.M., Pain D., Amutha B.", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "reference": [ { "type": "PubMed", "id": "15753074", "url": "https://glygen.org/publication/PubMed/15753074" } ] }, { "title": "A putative second adenylate kinase-encoding gene from the yeast Saccharomyces cerevisiae.", "journal": "Gene", "date": "1992", "authors": "Cooper A.J., Friedberg E.C.", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "reference": [ { "type": "PubMed", "id": "1587477", "url": "https://glygen.org/publication/PubMed/1587477" } ] }, { "title": "A new member of the adenylate kinase family in yeast: PAK3 is highly homologous to mammalian AK3 and is targeted to mitochondria.", "journal": "Mol. Gen. Genet.", "date": "1992", "authors": "Magdolen V., Bandlow W., Schricker R.", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "reference": [ { "type": "PubMed", "id": "1620094", "url": "https://glygen.org/publication/PubMed/1620094" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Strain-dependent occurrence of functional GTP:AMP phosphotransferase (AK3) in Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Bogengruber E., Breitenbach M., Magdolen V., Bandlow W., Schricker R., Strobel G.", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "reference": [ { "type": "PubMed", "id": "8537371", "url": "https://glygen.org/publication/PubMed/8537371" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome V.", "journal": "Nature", "date": "1997", "authors": "Smith V., Chen E., Guzman E., Chung E., Nakahara K., Botstein D., Davis R.W., Lin D., Wei Y., Duncan M., Berno A., Oh C., Oefner P., Taylor P., Lashkari D., Allen E., Hyman R.W., Araujo R., Komp C., Lew H., Namath A., Roberts D., Mulligan J.T., Sehl P., Schramm S., Hartzell G., Cherry J.M., Dietrich F.S., Aviles E., Brennan T., Carpenter J., Hennessy K.M., Hunicke-Smith S., Kayser A., Mosedale D., Norgren R., Petel F.X., Shogren T., Yelton M.A.", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "reference": [ { "type": "PubMed", "id": "9169868", "url": "https://glygen.org/publication/PubMed/9169868" } ] } ], "pathway": [ { "id": "sce:YER170W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YER170W", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P27144-1", "protein_name": "Adenylate kinase 4, mitochondrial", "gene_name": "AK4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY", "length": 223 }, "evidence": [ { "id": "P26364", "url": "https://omabrowser.org/oma/group/P26364/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9WUR9-1", "protein_name": "Adenylate kinase 4, mitochondrial", "gene_name": "Ak4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDGICDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY", "length": 223 }, "evidence": [ { "id": "P26364", "url": "https://omabrowser.org/oma/group/P26364/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "adenylate kinase activity", "id": "GO:0004017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004017", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "nucleoside triphosphate adenylate kinase activity", "id": "GO:0046899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046899", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "ADP biosynthetic process", "id": "GO:0006172", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006172", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "AMP metabolic process", "id": "GO:0046033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046033", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "ITP metabolic process", "id": "GO:0046041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046041", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "nucleotide metabolic process", "id": "GO:0009117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009117", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "GTP metabolic process", "id": "GO:0046039", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046039", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "nucleoside triphosphate biosynthetic process", "id": "GO:0009142", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009142", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "P26364", "url": "https://www.uniprot.org/uniprot/P26364" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "13749", "name": "", "equation": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P39069-1", "P29411-1", "Q9WUS0-1", "P27144-1", "Q9UIJ7-1", "P00568-1", "A0A8I5KW96-1", "Q9WUR9-1", "Q9WTP7-1", "Q9R0Y5-1", "P26364-1", "Q9VGU6-1" ], "evidence": [ { "id": "13749", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/13749" } ] }, { "id": "R-SCE-1008248", "name": "Adenylate Kinase 3 is a GTP-AMP phosphotransferase", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [ "R-ALL-113573" ], "output_participant_list": [ "R-ALL-113525" ], "enzyme_list": [ "P26364-1" ], "evidence": [ { "id": "R-SCE-1008248", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-1008248" } ] }, { "id": "R-SCE-6788798", "name": "AK4 phosphorylates (d)NMPs to (d)NDPs", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P26364-1" ], "evidence": [ { "id": "R-SCE-6788798", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-6788798" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-113525", "participant_name": "GDP [mitochondrial matrix]", "crossref": [ { "id": "C00035", "database": "COMPOUND", "url": "" }, { "id": "58189", "database": "ChEBI", "url": "" }, { "id": "000008215481", "database": "ZINC", "url": "" }, { "id": "C00035", "database": "COMPOUND", "url": "" }, { "id": "58189", "database": "ChEBI", "url": "" }, { "id": "000008215481", "database": "ZINC", "url": "" }, { "id": "C00035", "database": "COMPOUND", "url": "" }, { "id": "58189", "database": "ChEBI", "url": "" }, { "id": "000008215481", "database": "ZINC", "url": "" }, { "id": "C00035", "database": "COMPOUND", "url": "" }, { "id": "58189", "database": "ChEBI", "url": "" }, { "id": "000008215481", "database": "ZINC", "url": "" }, { "id": "C00035", "database": "COMPOUND", "url": "" }, { "id": "000008215481", "database": "ZINC", "url": "" }, { "id": "58189", "database": "ChEBI", "url": "" }, { "id": "C00035", "database": "COMPOUND", "url": "" }, { "id": "58189", "database": "ChEBI", "url": "" }, { "id": "000008215481", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-113573", "participant_name": "GTP [mitochondrial matrix]", "crossref": [ { "id": "C00044", "database": "COMPOUND", "url": "" }, { "id": "37565", "database": "ChEBI", "url": "" }, { "id": "000060094177", "database": "ZINC", "url": "" }, { "id": "000060094177", "database": "ZINC", "url": "" }, { "id": "C00044", "database": "COMPOUND", "url": "" }, { "id": "37565", "database": "ChEBI", "url": "" }, { "id": "000060094177", "database": "ZINC", "url": "" }, { "id": "C00044", "database": "COMPOUND", "url": "" }, { "id": "37565", "database": "ChEBI", "url": "" }, { "id": "C00044", "database": "COMPOUND", "url": "" }, { "id": "000060094177", "database": "ZINC", "url": "" }, { "id": "37565", "database": "ChEBI", "url": "" }, { "id": "C00044", "database": "COMPOUND", "url": "" }, { "id": "37565", "database": "ChEBI", "url": "" }, { "id": "000060094177", "database": "ZINC", "url": "" }, { "id": "37565", "database": "ChEBI", "url": "" }, { "id": "C00044", "database": "COMPOUND", "url": "" }, { "id": "000060094177", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A8I5KW96", "gene_name": "AK4P3", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] } ] }, { "uniprot_ac": "P00568", "gene_name": "AK1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] } ] }, { "uniprot_ac": "P26364", "gene_name": "ADK2", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P26364", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26364" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P26364", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26364" } ] } ] }, { "uniprot_ac": "P27144", "gene_name": "AK4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] } ] }, { "uniprot_ac": "P29411", "gene_name": "Ak3", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P29411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29411" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P29411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29411" } ] } ] }, { "uniprot_ac": "P39069", "gene_name": "Ak1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] } ] }, { "uniprot_ac": "Q9R0Y5", "gene_name": "Ak1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] } ] }, { "uniprot_ac": "Q9UIJ7", "gene_name": "AK3", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9UIJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIJ7" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9UIJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIJ7" } ] } ] }, { "uniprot_ac": "Q9VGU6", "gene_name": "Ak3", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9VGU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGU6" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9VGU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGU6" } ] } ] }, { "uniprot_ac": "Q9WTP7", "gene_name": "Ak3", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WTP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTP7" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WTP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTP7" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9WTP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTP7" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9WTP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTP7" } ] } ] }, { "uniprot_ac": "Q9WUR9", "gene_name": "Ak4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] } ] }, { "uniprot_ac": "Q9WUS0", "gene_name": "Ak4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }