{ "uniprot_canonical_ac": "P25236-1", "uniprot_ac": "P25236", "uniprot_id": "SEPP1_RAT", "mass": { "chemical_mass": 43083.0, "monoisotopic_mass": 43083.0 }, "refseq": {}, "gene_names": [ { "name": "Selenop", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P25236", "id": "P25236" }, { "name": "Selp", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P25236", "id": "P25236" }, { "name": "Sepp1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P25236", "id": "P25236" } ], "protein_names": [ { "name": "Selenoprotein P", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P25236" }, { "name": "SeP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P25236" } ], "function": [ { "annotation": "Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236#function" } ] } ], "disease": [ { "disease_id": "DOID:0050860", "recommended_name": { "id": "DOID:0050860", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050860", "name": "colorectal adenoma", "description": "An intestinal benign neoplasm that has_material_basis_in epithelial tissue of glandular origin and is located_in colon and located_in rectum." }, "synonyms": [], "evidence": [ { "id": "0050860", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050860" } ] }, { "disease_id": "DOID:0080199", "recommended_name": { "id": "DOID:0080199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080199", "name": "colorectal carcinoma", "description": "A colorectal cancer that arises from the colon or rectum and invades through the muscularis mucosa into the submucosa." }, "synonyms": [], "evidence": [ { "id": "0080199", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080199" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "common_name": "Rat" } ], "gene": [ { "name": "Selenop", "url": "https://www.uniprot.org/uniprot/P25236", "locus": { "chromosome": "2", "start_pos": 52508852, "end_pos": 52498339, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000053086", "url": "https://www.ensembl.org/id/ENSRNOG00000053086" } ] } } ], "crossref": [ { "id": "ENSRNOG00000053086", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000053086", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR007671", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007671", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007672", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007672", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037941", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037941", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:29360", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29360", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "XQASQQL", "url": "https://omabrowser.org/oma/group/XQASQQL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3683808at2759", "url": "http://www.orthodb.org/?query=3683808at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10105", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10105", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10105:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10105:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04592", "url": "http://pfam.xfam.org/family/PF04592", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04593", "url": "http://pfam.xfam.org/family/PF04593", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P25236", "url": "http://purl.obolibrary.org/obo/PR_P25236", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "3660", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=3660", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2JU99", "url": "https://www.uniprot.org/uniprot/A0A0G2JU99", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JU99-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JU99-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P25236-1", "url": "https://www.uniprot.org/uniprot/P25236-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWRSLGLALALCLLPYGGAESQGQSPACKQAPPWNIGDQNPMLNSEGTVTVVALLQASUYLCLLQASRLEDLRIKLENQGYFNISYIVVNHQGSPSQLKHAHLKKQVSDHIAVYRQDEHQTDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEKRCGNCSFTSLEDEAFCKNVSSATASKTTEPSEEHNHHKHHDKHGHEHLGSSKPSENQQPGALDVETSLPPSGLHHHHHHHKHKGQHRQGHLESUDMGASEGLQLSLAQRKLURRGCINQLLCKLSEESGAATSSCCCHCRHLIFEKSGSAITUQCAENLPSLCSUQGLFAEEKVIESCQCRSPPAAUHSQHVSPTEASPNUSUNNKTKKUKUNLN", "length": 385, "header": "sp|P25236-1|SEPP1_RAT Isoform 1 of Selenoprotein P OS=Rattus norvegicus OX=10116 GN=Selenop PE=1 SV=2 CANONICAL=P25236-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JU99-1", "url": "", "sequence": { "sequence": "MWRSLGLALALCLLPYGGAESQGQSPACKQAPPWNIGDQNPMLNSEGTVTVVALLQARHFMCFLPRLEDLRIKLENQGYFNISYIVVNHQGSPSQLKHAHLKKQVSDHIAVYRQDEHQTDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEKRCGNCSFTSLEDEAFCKNVSSATASKTTEPSEEHN", "length": 203, "header": "tr|A0A0G2JU99-1|A0A0G2JU99_RAT Computationally mapped isoform of Selenoprotein P OS=Rattus norvegicus OX=10116 GN=Selenop PE=1 SV=1 CANONICAL=P25236-1" }, "locus": { "chromosome": "2", "start_pos": 52507609, "end_pos": 52501895, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000086590", "url": "https://www.ensembl.org/id/ENSRNOT00000086590" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069020", "url": "https://www.ensembl.org/id/ENSRNOP00000069020" } ] } }, { "isoform_ac": "P25236-1", "url": "", "sequence": { "sequence": "MWRSLGLALALCLLPYGGAESQGQSPACKQAPPWNIGDQNPMLNSEGTVTVVALLQASUYLCLLQASRLEDLRIKLENQGYFNISYIVVNHQGSPSQLKHAHLKKQVSDHIAVYRQDEHQTDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEKRCGNCSFTSLEDEAFCKNVSSATASKTTEPSEEHNHHKHHDKHGHEHLGSSKPSENQQPGALDVETSLPPSGLHHHHHHHKHKGQHRQGHLESUDMGASEGLQLSLAQRKLURRGCINQLLCKLSEESGAATSSCCCHCRHLIFEKSGSAITUQCAENLPSLCSUQGLFAEEKVIESCQCRSPPAAUHSQHVSPTEASPNUSUNNKTKKUKUNLN", "length": 385, "header": "sp|P25236-1|SEPP1_RAT Isoform 1 of Selenoprotein P OS=Rattus norvegicus OX=10116 GN=Selenop PE=1 SV=2 CANONICAL=P25236-1" }, "locus": { "chromosome": "2", "start_pos": 52507609, "end_pos": 52501895, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000086590", "url": "https://www.ensembl.org/id/ENSRNOT00000086590" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069020", "url": "https://www.ensembl.org/id/ENSRNOP00000069020" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 174, "start_aa": "Asn", "end_pos": 174, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn174", "evidence": [ { "id": "P25236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25236#ptm_processing" }, { "id": "12911312", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12911312" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 188, "start_aa": "Asn", "end_pos": 188, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn188", "evidence": [ { "id": "P25236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25236#ptm_processing" }, { "id": "12911312", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12911312" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "Other", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (Hex...) threonine; partial Other", "start_pos": 365, "start_aa": "Thr", "end_pos": 365, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr365", "evidence": [ { "id": "P25236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25236#ptm_processing" }, { "id": "12911312", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12911312" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 83, "start_aa": "Asn", "end_pos": 83, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn83", "evidence": [ { "id": "P25236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25236#ptm_processing" }, { "id": "12911312", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12911312" } ] } ], "phosphorylation": [ { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "site_lbl": "Ser269" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "Mass spectrometric characterization of full-length rat selenoprotein P and three isoforms shortened at the C-terminus. Evidence that three UGA codons in the mRNA open reading frame have alternative functions of specifying selenocysteine insertion or translation termination.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Ma S, Hill KE, Caprioli RM, Burk RF", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "reference": [ { "type": "PubMed", "id": "11821412", "url": "https://glygen.org/publication/PubMed/11821412" } ] }, { "title": "Mass spectrometric identification of N- and O-glycosylation sites of full-length rat selenoprotein P and determination of selenide-sulfide and disulfide linkages in the shortest isoform.", "journal": "Biochemistry", "date": "2003", "authors": "Ma S, Hill KE, Burk RF, Caprioli RM", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236#ptm_processing" }, { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "reference": [ { "type": "PubMed", "id": "12911312", "url": "https://glygen.org/publication/PubMed/12911312" } ] }, { "title": "The cDNA for rat selenoprotein P contains 10 TGA codons in the open reading frame.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Lloyd R.S., Burk R.F., Hill K.E., Read R., Yang J.-G.", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "reference": [ { "type": "PubMed", "id": "2037562", "url": "https://glygen.org/publication/PubMed/2037562" } ] }, { "title": "Molecular cloning of cDNA encoding a bovine selenoprotein P-like protein containing 12 selenocysteines and a (His-Pro) rich domain insertion, and its regional expression.", "journal": "Brain Res. Mol. Brain Res.", "date": "1995", "authors": "Kobayashi T., Fujii M., Saito N., Lee M.J., Sumino K., Saijoh K.", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "reference": [ { "type": "PubMed", "id": "7637580", "url": "https://glygen.org/publication/PubMed/7637580" } ] }, { "title": "Selenoprotein P. A selenium-rich extracellular glycoprotein.", "journal": "J. Nutr.", "date": "1994", "authors": "Burk R.F., Hill K.E.", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "reference": [ { "type": "PubMed", "id": "7931697", "url": "https://glygen.org/publication/PubMed/7931697" } ] } ], "pathway": [ { "id": "rno:29360", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29360", "resource": "KEGG Pathway" }, { "id": "R-RNO-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-114608", "resource": "Reactome", "description": "Platelet degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P49908-1", "protein_name": "Selenoprotein P", "gene_name": "SELENOP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSUCCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPAAUQISQQLIPTEASASURUKNQAKKUEUPSN", "length": 381 }, "evidence": [ { "id": "P25236", "url": "https://omabrowser.org/oma/group/P25236/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P70274-1", "protein_name": "Selenoprotein P", "gene_name": "Selenop", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWRSLGLALALCLLPYGGAESQGQSSACYKAPEWYIGDQNPMLNSEGKVTVVALLQASUYLCLLQASRLEDLRIKLESQGYFNISYIVVNHQGSPSQLKHSHLKKQVSEHIAVYRQEEDGIDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEERCGNCNLTSLEDEDFCKTVTSATANKTAEPSEAHSHHKHHNKHGQEHLGSSKPSENQQPGPSETTLPPSGLHHHHRHRGQHRQGHLESUDTTASEGLHLSLAQRKLURRGCINQLLCKLSKESEAAPSSCCCHCRHLIFEKSGSAIAUQCAENLPSLCSUQGLFAEEKVTESCQCRSPPAAUQNQPMNPMEANPNUSUDNQTRKUKUHSN", "length": 380 }, "evidence": [ { "id": "P25236", "url": "https://omabrowser.org/oma/group/P25236/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "sexual reproduction", "id": "GO:0019953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019953", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" }, { "name": "locomotory behavior", "id": "GO:0007626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007626", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" }, { "name": "regulation of growth", "id": "GO:0040008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040008", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" }, { "name": "post-embryonic development", "id": "GO:0009791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009791", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" }, { "name": "response to selenium ion", "id": "GO:0010269", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010269", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" }, { "name": "selenium compound metabolic process", "id": "GO:0001887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001887", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "selenium binding", "id": "GO:0008430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008430", "evidence": [ { "database": "UniProtKB", "id": "P25236", "url": "https://www.uniprot.org/uniprot/P25236" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 174, "end_pos": 176, "annotation": "n_glycosylation_sequon" }, { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" }, { "start_pos": 370, "end_pos": 372, "annotation": "n_glycosylation_sequon" }, { "start_pos": 375, "end_pos": 377, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }