{
    "uniprot_canonical_ac": "P25046-1",
    "uniprot_ac": "P25046",
    "uniprot_id": "MED19_YEAST",
    "mass": {
        "chemical_mass": 24857.0,
        "monoisotopic_mass": 24857.0
    },
    "refseq": {
        "ac": "NP_009459",
        "name": "Rox3p",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009459"
    },
    "gene_names": [
        {
            "name": "ROX3",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P25046",
            "id": "P25046"
        },
        {
            "name": "MED19; NUT3; RMR1; SSN7; SSX2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009459",
            "id": "NP_009459"
        },
        {
            "name": "MED19",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P25046",
            "id": "P25046"
        },
        {
            "name": "NUT3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P25046",
            "id": "P25046"
        },
        {
            "name": "ROX3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009459",
            "id": "NP_009459"
        },
        {
            "name": "SSN7",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P25046",
            "id": "P25046"
        },
        {
            "name": "YBL0837",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P25046",
            "id": "P25046"
        }
    ],
    "protein_names": [
        {
            "name": "Mediator of RNA polymerase II transcription subunit 19",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P25046"
        },
        {
            "name": "Hypoxic gene repressor protein 3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P25046"
        },
        {
            "name": "Mediator complex subunit 19",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P25046"
        },
        {
            "name": "Negative regulator of URS2 protein 3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P25046"
        },
        {
            "name": "Rox3p",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009459",
            "id": "NP_009459"
        },
        {
            "name": "SNF1 suppressor protein 7",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P25046"
        }
    ],
    "function": [
        {
            "annotation": "Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046#function"
                },
                {
                    "database": "PubMed",
                    "id": "17192271",
                    "url": "https://glygen.org/publication/PubMed/17192271"
                },
                {
                    "database": "PubMed",
                    "id": "11555651",
                    "url": "https://glygen.org/publication/PubMed/11555651"
                },
                {
                    "database": "PubMed",
                    "id": "16263706",
                    "url": "https://glygen.org/publication/PubMed/16263706"
                },
                {
                    "database": "PubMed",
                    "id": "16076843",
                    "url": "https://glygen.org/publication/PubMed/16076843"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "ROX3",
            "url": "https://www.uniprot.org/uniprot/P25046",
            "locus": {
                "chromosome": "II",
                "start_pos": 44256,
                "end_pos": 44918,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "YBL093C",
                        "url": "https://www.ensembl.org/id/YBL093C"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "852184",
            "url": "https://www.ncbi.nlm.nih.gov/gene/852184",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P25046",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P25046*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR013942",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013942",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YBL093C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBL093C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "SYPTEFQ",
            "url": "https://omabrowser.org/oma/group/SYPTEFQ/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2719529at2759",
            "url": "http://www.orthodb.org/?query=2719529at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR28270",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28270",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR28270:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28270:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5OQM",
            "url": "https://www.rcsb.org/structure/5OQM",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7UI9",
            "url": "https://www.rcsb.org/structure/7UI9",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7UIF",
            "url": "https://www.rcsb.org/structure/7UIF",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7UIG",
            "url": "https://www.rcsb.org/structure/7UIG",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7UIO",
            "url": "https://www.rcsb.org/structure/7UIO",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF08633",
            "url": "http://pfam.xfam.org/family/PF08633",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P25046",
            "url": "http://purl.obolibrary.org/obo/PR_P25046",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_009459",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009459",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000000189",
            "url": "https://www.yeastgenome.org/locus/S000000189",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P25046",
            "url": "https://www.uniprot.org/uniprot/P25046",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P25046-1",
            "url": "https://www.uniprot.org/uniprot/P25046-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MASRVDETTVPSYYYYVDPETTYTYQQPNPLQDLISVYGLDDISRQVARTNLDGTKAVKLRKSYKNQIADLSGKFSTIPTRENGKGGQIAHILFQNNPDMMIQPPQQGQNMSEQQWREQLRNRDIALFQPPNFDWDLCSSVLSQFERSYPSEFANQNQGGAQAPFDIDDLAFDLDGTGKSQSGSNSGNNSKKRKNKSSGSSMATPTHSDSHEDMKRRRLE",
        "length": 220,
        "header": "sp|P25046-1|MED19_YEAST Isoform 1 of Mediator of RNA polymerase II transcription subunit 19  OS=Saccharomyces cerevisiae S288C OX=559292 GN=ROX3 PE=1 SV=3 CANONICAL=P25046-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P25046-1",
            "url": "",
            "sequence": {
                "sequence": "MASRVDETTVPSYYYYVDPETTYTYQQPNPLQDLISVYGLDDISRQVARTNLDGTKAVKLRKSYKNQIADLSGKFSTIPTRENGKGGQIAHILFQNNPDMMIQPPQQGQNMSEQQWREQLRNRDIALFQPPNFDWDLCSSVLSQFERSYPSEFANQNQGGAQAPFDIDDLAFDLDGTGKSQSGSNSGNNSKKRKNKSSGSSMATPTHSDSHEDMKRRRLE",
                "length": 220,
                "header": "sp|P25046-1|MED19_YEAST Isoform 1 of Mediator of RNA polymerase II transcription subunit 19  OS=Saccharomyces cerevisiae S288C OX=559292 GN=ROX3 PE=1 SV=3 CANONICAL=P25046-1"
            },
            "locus": {
                "chromosome": "II",
                "start_pos": 44918,
                "end_pos": 44259,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YBL093C_mRNA",
                        "url": "https://www.ensembl.org/id/YBL093C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YBL093C",
                        "url": "https://www.ensembl.org/id/YBL093C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 200,
            "end_pos": 200,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P25046",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25046"
                },
                {
                    "database": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                }
            ],
            "site_lbl": "Ser200"
        },
        {
            "start_pos": 201,
            "end_pos": 201,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P25046",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25046"
                },
                {
                    "database": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                },
                {
                    "database": "SGD",
                    "id": "P25046",
                    "url": "https://www.yeastgenome.org/locus/P25046"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Ser201"
        },
        {
            "start_pos": 204,
            "end_pos": 204,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P25046",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25046"
                },
                {
                    "database": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                },
                {
                    "database": "SGD",
                    "id": "P25046",
                    "url": "https://www.yeastgenome.org/locus/P25046"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Thr204"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The structural and functional organization of the yeast mediator complex.",
            "journal": "J. Biol. Chem.",
            "date": "2001",
            "authors": "Kim S.H., Kang J.S., Lee Y.C., Kim Y.-J., Han S.J., Hwang M.S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11555651",
                    "url": "https://glygen.org/publication/PubMed/11555651"
                }
            ]
        },
        {
            "title": "Structure of the yeast RNA polymerase II holoenzyme: mediator conformation and polymerase interaction.",
            "journal": "Mol. Cell",
            "date": "2002",
            "authors": "Takagi Y., Davis J.A., Kornberg R.D., Asturias F.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12191485",
                    "url": "https://glygen.org/publication/PubMed/12191485"
                }
            ]
        },
        {
            "title": "Global analysis of protein localization in budding yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562095",
                    "url": "https://glygen.org/publication/PubMed/14562095"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "A unified nomenclature for protein subunits of mediator complexes linking transcriptional regulators to RNA polymerase II.",
            "journal": "Mol. Cell",
            "date": "2004",
            "authors": "Bourbon HM, Aguilera A, Ansari AZ, Asturias FJ, Berk AJ, Bjorklund S, Blackwell TK, Borggrefe T, Carey M, Carlson M, Conaway JW, Conaway RC, Emmons SW, Fondell JD, Freedman LP, Fukasawa T, Gustafsson CM, Han M, He X, Herman PK, Hinnebusch AG, Holmberg S, Holstege FC, Jaehning JA, Kim YJ, Kuras L, Leutz A, Lis JT, Meisterernest M, Naar AM, Nasmyth K, Parvin JD, Ptashne M, Reinberg D, Ronne H, Sadowski I, Sakurai H, Sipiczki M, Sternberg PW, Stillman DJ, Strich R, Struhl K, Svejstrup JQ, Tuck S, Winston F, Roeder RG, Kornberg RD",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15175151",
                    "url": "https://glygen.org/publication/PubMed/15175151"
                }
            ]
        },
        {
            "title": "A high resolution protein interaction map of the yeast Mediator complex.",
            "journal": "Nucleic Acids Res.",
            "date": "2004",
            "authors": "Werner M., van Berkum N.L., Bijma T., Holstege F.C.P., Bourbon H.-M., Boube M., Boschiero C., Guglielmi B., Klapholz B.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15477388",
                    "url": "https://glygen.org/publication/PubMed/15477388"
                }
            ]
        },
        {
            "title": "Preponderance of free mediator in the yeast Saccharomyces cerevisiae.",
            "journal": "J. Biol. Chem.",
            "date": "2005",
            "authors": "Takagi Y., Davis J.A., Asturias F.J., Chadick J.Z.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16002404",
                    "url": "https://glygen.org/publication/PubMed/16002404"
                }
            ]
        },
        {
            "title": "Mediator and TFIIH govern carboxyl-terminal domain-dependent transcription in yeast extracts.",
            "journal": "J. Biol. Chem.",
            "date": "2005",
            "authors": "Kim Y., Nair D., Myers L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16076843",
                    "url": "https://glygen.org/publication/PubMed/16076843"
                }
            ]
        },
        {
            "title": "Mediator as a general transcription factor.",
            "journal": "J. Biol. Chem.",
            "date": "2006",
            "authors": "Takagi Y., Kornberg R.D.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16263706",
                    "url": "https://glygen.org/publication/PubMed/16263706"
                }
            ]
        },
        {
            "title": "The ROX3 gene encodes an essential nuclear protein involved in CYC7 gene expression in Saccharomyces cerevisiae.",
            "journal": "Mol. Cell. Biol.",
            "date": "1991",
            "authors": "Rosenblum-Vos L.S., Rhodes L., Evangelista C.C. Jr., Zitomer R.S., Boakye K.A.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1656237",
                    "url": "https://glygen.org/publication/PubMed/1656237"
                }
            ]
        },
        {
            "title": "Genome-wide location of the coactivator mediator: binding without activation and transient Cdk8 interaction on DNA.",
            "journal": "Mol. Cell",
            "date": "2006",
            "authors": "Werner M., van de Peppel J., Andrau J.-C., Bijma T., Holstege F.C.P., Koerkamp M.G., Lijnzaad P., van de Pasch L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16630888",
                    "url": "https://glygen.org/publication/PubMed/16630888"
                }
            ]
        },
        {
            "title": "Med19(Rox3) regulates intermodule interactions in the Saccharomyces cerevisiae mediator complex.",
            "journal": "J. Biol. Chem.",
            "date": "2007",
            "authors": "Baidoobonso S.M., Guidi B.W., Myers L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17192271",
                    "url": "https://glygen.org/publication/PubMed/17192271"
                }
            ]
        },
        {
            "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.",
            "journal": "Genome Res.",
            "date": "2007",
            "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17322287",
                    "url": "https://glygen.org/publication/PubMed/17322287"
                }
            ]
        },
        {
            "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.",
            "journal": "Science signaling",
            "date": "2010-12-21",
            "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P25046",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                }
            ]
        },
        {
            "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.",
            "journal": "Nature methods",
            "date": "2013-07",
            "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P25046",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II.",
            "journal": "Yeast",
            "date": "1995",
            "authors": "Gassenhuber J., Obermaier B., Domdey H., Piravandi E.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7502586",
                    "url": "https://glygen.org/publication/PubMed/7502586"
                }
            ]
        },
        {
            "title": "Complete DNA sequence of yeast chromosome II.",
            "journal": "EMBO J.",
            "date": "1994",
            "authors": "Gassenhuber J., Mewes H.-W., Obermaier B., Stucka R., Rose M., Wagner G., Boles E., Brueckner M., Jacquet M., Rieger M., Mueller S., Molemans F., Zagulski M., Brandt T., Christiansen C., Barthe C., Feldmann H., Kleine K., Cziepluch C., Fiers W., Mallet L., Jauniaux J.-C., Dubois E., Andre B., Li Z.Y., Koetter P., Hein C., Entian K.-D., Slonimski P.P., Vetter I., Nasr F., Louis E.J., Delaveau T., Hollenberg C.P., Contreras R., Domdey H., Pohl T.M., Brendel M., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Dujon B., El Bakkoury M., Feuermann M., Glansdorff N., Goffeau A., Grivell L.A., Herbert C.J., Jacq C., Mannhaupt G., Messenguy F., Miosga T., Perea J., Pierard A., Potier S., Proft M., Schaaff-Gerstenschlaeger I., Scherens B., Souciet J.-L., Steensma H.Y., Vissers S., Zimmermann F.K., Aljinovic G., Duesterhus S., Jonniaux J.-L., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Urrestarazu L.A., Vierendeels F., de Wergifosse P., Aigle M., Baclet M.C., Baur A., Biteau N., Demolis N., Fobo G.M., Fritz C., Holmstroem K., Kallesoee T., Kiesau P., Korol S., Liebl S., Logghe M., Lohan A.J.E., Maat M.J., Piravandi E., Pohl F.M., Schwarzlose C., Smits P.H.M., Van Dyck L., Vassarotti A., Wolfe K.H., de Haan M., van der Aart Q.J.M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7813418",
                    "url": "https://glygen.org/publication/PubMed/7813418"
                }
            ]
        },
        {
            "title": "Identification of Rox3 as a component of mediator and RNA polymerase II holoenzyme.",
            "journal": "J. Biol. Chem.",
            "date": "1997",
            "authors": "Li Y., Erdjument-Bromage H., Tempst P., Gustafsson C.M., Kornberg R.D., Lui M., Redd M.J., Myers L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P25046",
                    "url": "https://www.uniprot.org/uniprot/P25046"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8995225",
                    "url": "https://glygen.org/publication/PubMed/8995225"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YBL093C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBL093C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 7,
                "go_terms": [
                    {
                        "name": "positive regulation of transcription initiation by RNA polymerase II",
                        "id": "GO:0060261",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060261",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of transcription by RNA polymerase II",
                        "id": "GO:0000122",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of transcription by RNA polymerase II",
                        "id": "GO:0006357",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of transcription by RNA polymerase II",
                        "id": "GO:0045944",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transcription open complex formation at RNA polymerase II promoter",
                        "id": "GO:0001113",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001113",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of transcription elongation by RNA polymerase II",
                        "id": "GO:0032968",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032968",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "RNA polymerase II preinitiation complex assembly",
                        "id": "GO:0051123",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051123",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "transcription coactivator activity",
                        "id": "GO:0003713",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transcription coregulator activity",
                        "id": "GO:0003712",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003712",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mediator complex",
                        "id": "GO:0016592",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016592",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "core mediator complex",
                        "id": "GO:0070847",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070847",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P25046",
                                "url": "https://www.uniprot.org/uniprot/P25046"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 110,
            "end_pos": 112,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 188,
            "end_pos": 190,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 195,
            "end_pos": 197,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 19
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}