{ "uniprot_canonical_ac": "P24844-1", "uniprot_ac": "P24844", "uniprot_id": "MYL9_HUMAN", "mass": { "chemical_mass": 19827.0, "monoisotopic_mass": 19827.0 }, "refseq": { "ac": "NP_006088", "name": "myosin regulatory light polypeptide 9 isoform a", "summary": "Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" }, "gene_names": [ { "name": "MYL9", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P24844", "id": "P24844" }, { "name": "LC20; MLC-2C; MLC2; MMIHS4; MRLC1; MYRL2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088", "id": "NP_006088" }, { "name": "MLC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P24844", "id": "P24844" }, { "name": "MRLC1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P24844", "id": "P24844" }, { "name": "MYL9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088", "id": "NP_006088" }, { "name": "MYRL2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P24844", "id": "P24844" } ], "protein_names": [ { "name": "Myosin regulatory light polypeptide 9", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P24844" }, { "name": "20 kDa myosin light chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24844" }, { "name": "LC20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24844" }, { "name": "MLC-2C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24844" }, { "name": "Myosin RLC", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24844" }, { "name": "Myosin regulatory light chain 2, smooth muscle isoform", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24844" }, { "name": "Myosin regulatory light chain 9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24844" }, { "name": "Myosin regulatory light chain MRLC1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24844" }, { "name": "myosin regulatory light chain 1; myosin RLC; myosin regulatory light polypeptide 9; myosin, light polypeptide 9, regulatory; myosin, light chain 9, regulatory; 20 kDa myosin light chain; myosin regulatory light chain 9; myosin regulatory light chain MRLC1; epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088", "id": "NP_006088" }, { "name": "myosin regulatory light polypeptide 9 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088", "id": "NP_006088" } ], "function": [ { "annotation": "Clinicopathological significance of MYL9 expression in pancreatic ductal adenocarcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" }, { "database": "PubMed", "id": "34821071", "url": "https://glygen.org/publication/PubMed/34821071" } ] }, { "annotation": "Elevated Myl9 reflects the Myl9-containing microthrombi in SARS-CoV-2-induced lung exudative vasculitis and predicts COVID-19 severity.", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" }, { "database": "PubMed", "id": "35895716", "url": "https://glygen.org/publication/PubMed/35895716" } ] }, { "annotation": "Increased Myosin light chain 9 expression during Kawasaki disease vasculitis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" }, { "database": "PubMed", "id": "36685558", "url": "https://glygen.org/publication/PubMed/36685558" } ] }, { "annotation": "Myosin light chain 9 promotes the proliferation, invasion, migration and angiogenesis of colorectal cancer cells by binding to Yes-associated protein 1 and regulating Hippo signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" }, { "database": "PubMed", "id": "34974798", "url": "https://glygen.org/publication/PubMed/34974798" } ] }, { "annotation": "Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion (PubMed:11942626, PubMed:2526655). In myoblasts, may regulate PIEZO1-dependent cortical actomyosin assembly involved in myotube formation (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844#function" }, { "database": "PubMed", "id": "2526655", "url": "https://glygen.org/publication/PubMed/2526655" }, { "database": "UniProtKB", "id": "Q9CQ19", "url": "https://www.uniprot.org/uniprot/Q9CQ19#function" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" } ] }, { "annotation": "Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" } ] }, { "annotation": "Research progress in myosin light chain 9 in malignant tumors.', trans '9.", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" }, { "database": "PubMed", "id": "34911847", "url": "https://glygen.org/publication/PubMed/34911847" } ] }, { "annotation": "The FHC-mediated structural perturbations in RLC that affect Ca(2+) binding properties of mutated myocardium are responsible for triggering the abnormal function of the heart that in turn might initiate a hypertrophic process and lead to heart failure.", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" }, { "database": "PubMed", "id": "16076902", "url": "https://glygen.org/publication/PubMed/16076902" } ] } ], "disease": [ { "disease_id": "MONDO:0030296", "recommended_name": { "id": "MONDO:0030296", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030296", "name": "megacystis-microcolon-intestinal hypoperistalsis syndrome 4", "description": "" }, "synonyms": [ { "id": "MONDO:0030296", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030296", "name": "MMIHS4", "description": "" }, { "id": "MONDO:0030296", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030296", "name": "megacystis-microcolon-intestinal hypoperistalsis syndrome 4", "description": "" }, { "id": "MIM:619365", "resource": "MIM", "url": "https://www.omim.org/entry/619365", "name": "Megacystis-microcolon-intestinal hypoperistalsis syndrome 4", "description": "Megacystis-microcolon-intestinal hypoperistalsis syndrome 4" } ], "evidence": [ { "id": "619365", "database": "MIM", "url": "https://www.omim.org/entry/619365" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "94.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "78.88", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "97.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "87.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P24844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24844" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "common_name": "Human" } ], "gene": [ { "name": "MYL9", "url": "https://www.uniprot.org/uniprot/P24844", "locus": { "chromosome": "20", "start_pos": 36551447, "end_pos": 36541497, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000101335", "url": "https://www.ensembl.org/id/ENSG00000101335" } ] } } ], "crossref": [ { "id": "ENSG00000101335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101335", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00051", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00051", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "MYL9", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MYL9", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "10398", "url": "https://www.ncbi.nlm.nih.gov/gene/10398", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "15754", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=15754", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P24844", "url": "https://www.ebi.ac.uk/intact/interactors/id:P24844*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10398", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10398", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "609905", "url": "http://www.omim.org/entry/609905", "database": "MIM", "categories": [ "Other" ] }, { "id": "619365", "url": "http://www.omim.org/entry/619365", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P24844", "url": "https://www.nextprot.org/entry/NX_P24844", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "P24844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P24844", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "GFVDHED", "url": "https://omabrowser.org/oma/group/GFVDHED/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "312751at2759", "url": "http://www.orthodb.org/?query=312751at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23049", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23049", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23049:SF66", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23049:SF66", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13405", "url": "http://pfam.xfam.org/family/PF13405", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13833", "url": "http://pfam.xfam.org/family/PF13833", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P24844", "url": "https://pharos.nih.gov/targets/P24844", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P24844", "url": "http://purl.obolibrary.org/obo/PR_P24844", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3928663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5627117", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627117", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P24844-1", "url": "https://www.uniprot.org/uniprot/P24844-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P24844-2", "url": "https://www.uniprot.org/uniprot/P24844-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD", "length": 172, "header": "sp|P24844-1|MYL9_HUMAN Isoform 1 of Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9 PE=1 SV=4 CANONICAL=P24844-1" }, "isoforms": [ { "isoform_ac": "P24844-1", "url": "", "sequence": { "sequence": "MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD", "length": 172, "header": "sp|P24844-1|MYL9_HUMAN Isoform 1 of Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9 PE=1 SV=4 CANONICAL=P24844-1" }, "locus": { "chromosome": "20", "start_pos": 36549246, "end_pos": 36544885, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000279022.7", "url": "https://www.ensembl.org/id/ENST00000279022.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000279022.2", "url": "https://www.ensembl.org/id/ENSP00000279022.2" } ] } }, { "isoform_ac": "P24844-2", "url": "", "sequence": { "sequence": "MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD", "length": 118, "header": "sp|P24844-2|MYL9_HUMAN Isoform 2 of Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9 PE=1 SV=4 CANONICAL=P24844-1" }, "locus": { "chromosome": "20", "start_pos": 36549246, "end_pos": 36544885, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000346786.2", "url": "https://www.ensembl.org/id/ENST00000346786.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000217313.2", "url": "https://www.ensembl.org/id/ENSP00000217313.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P24844", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P24844" }, { "id": "36580660", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36580660" } ] } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "22136066", "url": "https://glygen.org/publication/PubMed/22136066" } ], "site_lbl": "Thr10" }, { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "P00533-1", "kinase_gene_name": "EGFR", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P24844", "url": "http://phospho.elm.eu.org/byAccession/P24844.html" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "8578591", "url": "https://glygen.org/publication/PubMed/8578591" } ], "site_lbl": "Tyr143" }, { "start_pos": 156, "end_pos": 156, "kinase_uniprot_canonical_ac": "P00533-1", "kinase_gene_name": "EGFR", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P24844", "url": "http://phospho.elm.eu.org/byAccession/P24844.html" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "8578591", "url": "https://glygen.org/publication/PubMed/8578591" } ], "site_lbl": "Tyr156" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "O43293-1", "kinase_gene_name": "DAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P24844", "url": "http://phospho.elm.eu.org/byAccession/P24844.html" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "15096528", "url": "https://glygen.org/publication/PubMed/15096528" }, { "database": "PubMed", "id": "19851336", "url": "https://glygen.org/publication/PubMed/19851336" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "O75116-1", "kinase_gene_name": "ROCK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "8702756", "url": "https://glygen.org/publication/PubMed/8702756" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "Q15746-1", "kinase_gene_name": "MYLK", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "19851336", "url": "https://glygen.org/publication/PubMed/19851336" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "Q5VT25-1", "kinase_gene_name": "CDC42BPA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "19851336", "url": "https://glygen.org/publication/PubMed/19851336" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MLCK, CIT and ROCK2", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "15723050", "url": "https://glygen.org/publication/PubMed/15723050" }, { "database": "phospho.ELM", "id": "P24844", "url": "http://phospho.elm.eu.org/byAccession/P24844.html" }, { "database": "PubMed", "id": "2526655", "url": "https://glygen.org/publication/PubMed/2526655" }, { "database": "PRO", "id": "P24844", "url": "http://purl.obolibrary.org/obo/P24844" }, { "database": "PubMed", "id": "21457715", "url": "https://glygen.org/publication/PubMed/21457715" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" } ], "site_lbl": "Thr19" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "O43293-1", "kinase_gene_name": "DAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P24844", "url": "http://phospho.elm.eu.org/byAccession/P24844.html" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "10356987", "url": "https://glygen.org/publication/PubMed/10356987" }, { "database": "PubMed", "id": "19851336", "url": "https://glygen.org/publication/PubMed/19851336" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "O75116-1", "kinase_gene_name": "ROCK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "17015463", "url": "https://glygen.org/publication/PubMed/17015463" }, { "database": "PubMed", "id": "8702756", "url": "https://glygen.org/publication/PubMed/8702756" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P24844", "url": "http://phospho.elm.eu.org/byAccession/P24844.html" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "10047984", "url": "https://glygen.org/publication/PubMed/10047984" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "Q13464-1", "kinase_gene_name": "ROCK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "8702756", "url": "https://glygen.org/publication/PubMed/8702756" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "Q14012-1", "kinase_gene_name": "CAMK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "12081505", "url": "https://glygen.org/publication/PubMed/12081505" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "Q15746-1", "kinase_gene_name": "MYLK", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "19851336", "url": "https://glygen.org/publication/PubMed/19851336" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "Q5VT25-1", "kinase_gene_name": "CDC42BPA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "21457715", "url": "https://glygen.org/publication/PubMed/21457715" }, { "database": "PubMed", "id": "19851336", "url": "https://glygen.org/publication/PubMed/19851336" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "Q9Y5S2-1", "kinase_gene_name": "CDC42BPB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "10947843", "url": "https://glygen.org/publication/PubMed/10947843" }, { "database": "PubMed", "id": "21457715", "url": "https://glygen.org/publication/PubMed/21457715" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDC42BP, CIT, MLCK, PAK1, ROCK1, ROCK2, DAPK1, DAPK2 and ZIPK/DAPK3", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "IntAct", "id": "P24844", "url": "https://www.ebi.ac.uk/intact/interactors/id:P24844*" }, { "database": "PubMed", "id": "20956536", "url": "https://glygen.org/publication/PubMed/20956536" }, { "database": "PubMed", "id": "15723050", "url": "https://glygen.org/publication/PubMed/15723050" }, { "database": "phospho.ELM", "id": "P24844", "url": "http://phospho.elm.eu.org/byAccession/P24844.html" }, { "database": "PubMed", "id": "2526655", "url": "https://glygen.org/publication/PubMed/2526655" }, { "database": "PRO", "id": "P24844", "url": "http://purl.obolibrary.org/obo/P24844" }, { "database": "PubMed", "id": "18854160", "url": "https://glygen.org/publication/PubMed/18854160" }, { "database": "PubMed", "id": "21072057", "url": "https://glygen.org/publication/PubMed/21072057" }, { "database": "PubMed", "id": "21408167", "url": "https://glygen.org/publication/PubMed/21408167" }, { "database": "PubMed", "id": "21457715", "url": "https://glygen.org/publication/PubMed/21457715" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" } ], "site_lbl": "Ser20" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "22136066", "url": "https://glygen.org/publication/PubMed/22136066" } ], "site_lbl": "Ser2" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "22136066", "url": "https://glygen.org/publication/PubMed/22136066" } ], "site_lbl": "Ser3" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Phosphorylation of non-muscle myosin II regulatory light chain by p21-activated kinase (gamma-PAK).", "journal": "Journal of muscle research and cell motility", "date": "1998", "authors": "Chew TL, Masaracchia RA, Goeckeler ZM, Wysolmerski RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "10047984", "url": "https://glygen.org/publication/PubMed/10047984" } ] }, { "title": "Inhibition of myosin light chain kinase by p21-activated kinase.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Sanders LC, Matsumura F, Bokoch GM, de Lanerolle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10092231", "url": "https://glygen.org/publication/PubMed/10092231" } ] }, { "title": "Cytoplasmic localization of human cdc25C during interphase requires an intact 14-3-3 binding site.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Dalal SN, Schweitzer CM, Gan J, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10330186", "url": "https://glygen.org/publication/PubMed/10330186" } ] }, { "title": "ZIP kinase identified as a novel myosin regulatory light chain kinase in HeLa cells.", "journal": "FEBS letters", "date": "1999", "authors": "Murata-Hori M, Suizu F, Iwasaki T, Kikuchi A, Hosoya H", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "10356987", "url": "https://glygen.org/publication/PubMed/10356987" } ] }, { "title": "p21-activated protein kinase: a crucial component of morphological signaling?", "journal": "Trends in biochemical sciences", "date": "1999", "authors": "Daniels RH, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10470034", "url": "https://glygen.org/publication/PubMed/10470034" } ] }, { "title": "A mechanism of repression by acute myeloid leukemia-1, the target of multiple chromosomal translocations in acute leukemia.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lutterbach B, Westendorf JJ, Linggi B, Isaac S, Seto E, Hiebert SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "10617663", "url": "https://glygen.org/publication/PubMed/10617663" } ] }, { "title": "The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.", "journal": "Molecular cell", "date": "1999", "authors": "Maesaki R, Ihara K, Shimizu T, Kuroda S, Kaibuchi K, Hakoshima T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10619026", "url": "https://glygen.org/publication/PubMed/10619026" } ] }, { "title": "Endothelial cell retraction is induced by PAK2 monophosphorylation of myosin II.", "journal": "Journal of cell science", "date": "2000", "authors": "Zeng Q, Lagunoff D, Masaracchia R, Goeckeler Z, Cote G, Wysolmerski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10639334", "url": "https://glygen.org/publication/PubMed/10639334" } ] }, { "title": "Rho-associated kinase ROCK activates LIM-kinase 1 by phosphorylation at threonine 508 within the activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ohashi K, Nagata K, Maekawa M, Ishizaki T, Narumiya S, Mizuno K", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "10652353", "url": "https://glygen.org/publication/PubMed/10652353" } ] }, { "title": "Phosphorylation of myosin light chain kinase by p21-activated kinase PAK2.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Goeckeler ZM, Masaracchia RA, Zeng Q, Chew TL, Gallagher P, Wysolmerski RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10748018", "url": "https://glygen.org/publication/PubMed/10748018" } ] }, { "title": "Rho GTPase control of protein kinase C-related protein kinase activation by 3-phosphoinositide-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Flynn P, Mellor H, Casamassima A, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10753910", "url": "https://glygen.org/publication/PubMed/10753910" } ] }, { "title": "Ephrin-A5 induces collapse of growth cones by activating Rho and Rho kinase.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Wahl S, Barth H, Ciossek T, Aktories K, Mueller BK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663" } ], "reference": [ { "type": "PubMed", "id": "10769020", "url": "https://glygen.org/publication/PubMed/10769020" } ] }, { "title": "Phosphorylation of CPI-17, an inhibitor of myosin phosphatase, by protein kinase N.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Hamaguchi T, Ito M, Feng J, Seko T, Koyama M, Machida H, Takase K, Amano M, Kaibuchi K, Hartshorne DJ, Nakano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10924361", "url": "https://glygen.org/publication/PubMed/10924361" } ] }, { "title": "Phosphorylation of ERM proteins at filopodia induced by Cdc42.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2000", "authors": "Nakamura N, Oshiro N, Fukata Y, Amano M, Fukata M, Kuroda S, Matsuura Y, Leung T, Lim L, Kaibuchi K", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "10947843", "url": "https://glygen.org/publication/PubMed/10947843" } ] }, { "title": "Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.", "journal": "Cell", "date": "2000", "authors": "Lei M, Lu W, Meng W, Parrini MC, Eck MJ, Mayer BJ, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10975528", "url": "https://glygen.org/publication/PubMed/10975528" } ] }, { "title": "Mibefradil block of cloned T-type calcium channels.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2000", "authors": "Martin RL, Lee JH, Cribbs LL, Perez-Reyes E, Hanck DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "10991994", "url": "https://glygen.org/publication/PubMed/10991994" } ] }, { "title": "Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Sumi T, Matsumoto K, Nakamura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "11018042", "url": "https://glygen.org/publication/PubMed/11018042" } ] }, { "title": "PKN delays mitotic timing by inhibition of Cdc25C: possible involvement of PKN in the regulation of cell division.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Misaki K, Mukai H, Yoshinaga C, Oishi K, Isagawa T, Takahashi M, Ohsumi K, Kishimoto T, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11134534", "url": "https://glygen.org/publication/PubMed/11134534" } ] }, { "title": "Rho GTPases in growth cone guidance.", "journal": "Current opinion in neurobiology", "date": "2001", "authors": "Dickson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663" } ], "reference": [ { "type": "PubMed", "id": "11179879", "url": "https://glygen.org/publication/PubMed/11179879" } ] }, { "title": "NO-independent regulatory site on soluble guanylate cyclase.", "journal": "Nature", "date": "2001", "authors": "Stasch JP, Becker EM, Alonso-Alija C, Apeler H, Dembowsky K, Feurer A, Gerzer R, Minuth T, Perzborn E, Pleiss U, Schroder H, Schroeder W, Stahl E, Steinke W, Straub A, Schramm M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11242081", "url": "https://glygen.org/publication/PubMed/11242081" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Localization of human Cdc25C is regulated both by nuclear export and 14-3-3 protein binding.", "journal": "Oncogene", "date": "2001", "authors": "Graves PR, Lovly CM, Uy GL, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11313932", "url": "https://glygen.org/publication/PubMed/11313932" } ] }, { "title": "Rho-kinase--mediated contraction of isolated stress fibers.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Katoh K, Kano Y, Amano M, Onishi H, Kaibuchi K, Fujiwara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11331307", "url": "https://glygen.org/publication/PubMed/11331307" } ] }, { "title": "Invited review: cross-bridge regulation by thin filament-associated proteins.", "journal": "Journal of applied physiology (Bethesda, Md. : 1985)", "date": "2001", "authors": "Morgan KG, Gangopadhyay SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11457814", "url": "https://glygen.org/publication/PubMed/11457814" } ] }, { "title": "The sarcolemmal proteins dysferlin and caveolin-3 interact in skeletal muscle.", "journal": "Human molecular genetics", "date": "2001", "authors": "Matsuda C, Hayashi YK, Ogawa M, Aoki M, Murayama K, Nishino I, Nonaka I, Arahata K, Brown RH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11532985", "url": "https://glygen.org/publication/PubMed/11532985" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "Functional and biochemical analysis of endothelial (dys)function and NO/cGMP signaling in human blood vessels with and without nitroglycerin pretreatment.", "journal": "Circulation", "date": "2002", "authors": "Schulz E, Tsilimingas N, Rinze R, Reiter B, Wendt M, Oelze M, Woelken-Weckmuller S, Walter U, Reichenspurner H, Meinertz T, Munzel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11889009", "url": "https://glygen.org/publication/PubMed/11889009" } ] }, { "title": "Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells.", "journal": "Cell Struct. Funct.", "date": "2001", "authors": "Iwasaki T, Murata-Hori M, Ishitobi S, Hosoya H", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" } ] }, { "title": "Identification of the enzymatic mechanism of nitroglycerin bioactivation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Chen Z, Zhang J, Stamler JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "12048254", "url": "https://glygen.org/publication/PubMed/12048254" } ] }, { "title": "Characterization of Ca2+/calmodulin-dependent protein kinase I as a myosin II regulatory light chain kinase in vitro and in vivo.", "journal": "The Biochemical journal", "date": "2002", "authors": "Suizu F, Fukuta Y, Ueda K, Iwasaki T, Tokumitsu H, Hosoya H", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "12081505", "url": "https://glygen.org/publication/PubMed/12081505" } ] }, { "title": "Rho-kinase contributes to diphosphorylation of myosin II regulatory light chain in nonmuscle cells.", "journal": "Oncogene", "date": "2002", "authors": "Ueda K, Murata-Hori M, Tatsuka M, Hosoya H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12185584", "url": "https://glygen.org/publication/PubMed/12185584" } ] }, { "title": "The semaphorin receptor plexin-B1 signals through a direct interaction with the Rho-specific nucleotide exchange factor, LARG.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Aurandt J, Vikis HG, Gutkind JS, Ahn N, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12196628", "url": "https://glygen.org/publication/PubMed/12196628" } ] }, { "title": "Filamin is essential in actin cytoskeletal assembly mediated by p21-activated kinase 1.", "journal": "Nature cell biology", "date": "2002", "authors": "Vadlamudi RK, Li F, Adam L, Nguyen D, Ohta Y, Stossel TP, Kumar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "12198493", "url": "https://glygen.org/publication/PubMed/12198493" } ] }, { "title": "Interaction of plexin-B1 with PDZ domain-containing Rho guanine nucleotide exchange factors.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Hirotani M, Ohoka Y, Yamamoto T, Nirasawa H, Furuyama T, Kogo M, Matsuya T, Inagaki S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12220504", "url": "https://glygen.org/publication/PubMed/12220504" } ] }, { "title": "Cdc42/Rac1-dependent activation of the p21-activated kinase (PAK) regulates human platelet lamellipodia spreading: implication of the cortical-actin binding protein cortactin.", "journal": "Blood", "date": "2002", "authors": "Vidal C, Geny B, Melle J, Jandrot-Perrus M, Fontenay-Roupie M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "12453877", "url": "https://glygen.org/publication/PubMed/12453877" } ] }, { "title": "Molecular cloning and characterization of the GATA1 cofactor human FOG1 and assessment of its binding to GATA1 proteins carrying D218 substitutions.", "journal": "Human genetics", "date": "2003", "authors": "Freson K, Thys C, Wittewrongel C, Vermylen J, Hoylaerts MF, Van Geet C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "12483298", "url": "https://glygen.org/publication/PubMed/12483298" } ] }, { "title": "RUNX1 and GATA-1 coexpression and cooperation in megakaryocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Elagib KE, Racke FK, Mogass M, Khetawat R, Delehanty LL, Goldfarb AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "12576332", "url": "https://glygen.org/publication/PubMed/12576332" } ] }, { "title": "Direct interaction of Rnd1 with Plexin-B1 regulates PDZ-RhoGEF-mediated Rho activation by Plexin-B1 and induces cell contraction in COS-7 cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oinuma I, Katoh H, Harada A, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12730235", "url": "https://glygen.org/publication/PubMed/12730235" } ] }, { "title": "Hyperosmotic-induced protein kinase N 1 activation in a vesicular compartment is dependent upon Rac1 and 3-phosphoinositide-dependent kinase 1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Torbett NE, Casamassima A, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "12783890", "url": "https://glygen.org/publication/PubMed/12783890" } ] }, { "title": "Citron kinase, a Rho-dependent kinase, induces di-phosphorylation of regulatory light chain of myosin II.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Yamashiro S, Totsukawa G, Yamakita Y, Sasaki Y, Madaule P, Ishizaki T, Narumiya S, Matsumura F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "12802051", "url": "https://glygen.org/publication/PubMed/12802051" } ] }, { "title": "Dysferlin interacts with annexins A1 and A2 and mediates sarcolemmal wound-healing.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lennon NJ, Kho A, Bacskai BJ, Perlmutter SL, Hyman BT, Brown RH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "14506282", "url": "https://glygen.org/publication/PubMed/14506282" } ] }, { "title": "Molecular dissection of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1 (PRK1).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Owen D, Lowe PN, Nietlispach D, Brosnan CE, Chirgadze DY, Parker PJ, Blundell TL, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "14514689", "url": "https://glygen.org/publication/PubMed/14514689" } ] }, { "title": "Merlin, the product of the Nf2 tumor suppressor gene, is an inhibitor of the p21-activated kinase, Pak1.", "journal": "Molecular cell", "date": "2003", "authors": "Kissil JL, Wilker EW, Johnson KC, Eckman MS, Yaffe MB, Jacks T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "14580336", "url": "https://glygen.org/publication/PubMed/14580336" } ] }, { "title": "Smooth muscle contraction and relaxation.", "journal": "Advances in physiology education", "date": "2003", "authors": "Webb RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "14627618", "url": "https://glygen.org/publication/PubMed/14627618" } ] }, { "title": "A clue to the therapy of neurofibromatosis type 2: NF2/merlin is a PAK1 inhibitor.", "journal": "Cancer journal (Sudbury, Mass.)", "date": "2004", "authors": "Hirokawa Y, Tikoo A, Huynh J, Utermark T, Hanemann CO, Giovannini M, Xiao GH, Testa JR, Wood J, Maruta H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "15000491", "url": "https://glygen.org/publication/PubMed/15000491" } ] }, { "title": "Association of CPI-17 with protein kinase C and casein kinase I.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Zemlickova E, Johannes FJ, Aitken A, Dubois T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15003508", "url": "https://glygen.org/publication/PubMed/15003508" } ] }, { "title": "ZIP kinase is responsible for the phosphorylation of myosin II and necessary for cell motility in mammalian fibroblasts.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Komatsu S, Ikebe M", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "15096528", "url": "https://glygen.org/publication/PubMed/15096528" } ] }, { "title": "Phosphoprotein inhibitor CPI-17 specificity depends on allosteric regulation of protein phosphatase-1 by regulatory subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Eto M, Kitazawa T, Brautigan DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15184667", "url": "https://glygen.org/publication/PubMed/15184667" } ] }, { "title": "Plexin-B1/RhoGEF-mediated RhoA activation involves the receptor tyrosine kinase ErbB-2.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Swiercz JM, Kuner R, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "15210733", "url": "https://glygen.org/publication/PubMed/15210733" } ] }, { "title": "Contribution of aldehyde dehydrogenase to mitochondrial bioactivation of nitroglycerin: evidence for the activation of purified soluble guanylate cyclase through direct formation of nitric oxide.", "journal": "The Biochemical journal", "date": "2005", "authors": "Kollau A, Hofer A, Russwurm M, Koesling D, Keung WM, Schmidt K, Brunner F, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "15377279", "url": "https://glygen.org/publication/PubMed/15377279" } ] }, { "title": "Serine 518 phosphorylation modulates merlin intramolecular association and binding to critical effectors important for NF2 growth suppression.", "journal": "Oncogene", "date": "2004", "authors": "Rong R, Surace EI, Haipek CA, Gutmann DH, Ye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "15378014", "url": "https://glygen.org/publication/PubMed/15378014" } ] }, { "title": "Human platelet myosin light chain kinase requires the calcium-binding protein calmodulin for activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Hathaway DR, Adelstein RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "156362", "url": "https://glygen.org/publication/PubMed/156362" } ] }, { "title": "Cdc42-MRCK and Rho-ROCK signalling cooperate in myosin phosphorylation and cell invasion.", "journal": "Nature cell biology", "date": "2005", "authors": "Wilkinson S, Paterson HF, Marshall CJ", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "15723050", "url": "https://glygen.org/publication/PubMed/15723050" } ] }, { "title": "Involvement of protein kinase PKN1 in G2/M delay caused by arsenite.", "journal": "Molecular carcinogenesis", "date": "2005", "authors": "Isagawa T, Takahashi M, Kato T Jr, Mukai H, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15791647", "url": "https://glygen.org/publication/PubMed/15791647" } ] }, { "title": "Eph-dependent tyrosine phosphorylation of ephexin1 modulates growth cone collapse.", "journal": "Neuron", "date": "2005", "authors": "Sahin M, Greer PL, Lin MZ, Poucher H, Eberhart J, Schmidt S, Wright TM, Shamah SM, O'connell S, Cowan CW, Hu L, Goldberg JL, Debant A, Corfas G, Krull CE, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663" } ], "reference": [ { "type": "PubMed", "id": "15848799", "url": "https://glygen.org/publication/PubMed/15848799" } ] }, { "title": "The E22K mutation of myosin RLC that causes familial hypertrophic cardiomyopathy increases calcium sensitivity of force and ATPase in transgenic mice.", "journal": "Journal of cell science", "date": "2005", "authors": "Szczesna-Cordary D, Guzman G, Zhao J, Hernandez O, Wei J, Diaz-Perez Z", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" } ], "reference": [ { "type": "PubMed", "id": "16076902", "url": "https://glygen.org/publication/PubMed/16076902" } ] }, { "title": "Targeting and clustering citron to synapses.", "journal": "Molecular and cellular neurosciences", "date": "2006", "authors": "Zhang W, Benson DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "16202622", "url": "https://glygen.org/publication/PubMed/16202622" } ] }, { "title": "Regulation of the interaction of Pak2 with Cdc42 via autophosphorylation of serine 141.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Jung JH, Traugh JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "16204230", "url": "https://glygen.org/publication/PubMed/16204230" } ] }, { "title": "Regulation of LIM-kinase 1 and cofilin in thrombin-stimulated platelets.", "journal": "Blood", "date": "2006", "authors": "Pandey D, Goyal P, Bamburg JR, Siess W", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "16219803", "url": "https://glygen.org/publication/PubMed/16219803" } ] }, { "title": "KIF14 and citron kinase act together to promote efficient cytokinesis.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Gruneberg U, Neef R, Li X, Chan EH, Chalamalasetty RB, Nigg EA, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "16431929", "url": "https://glygen.org/publication/PubMed/16431929" } ] }, { "title": "Physical association of the patient-specific GATA1 mutants with RUNX1 in acute megakaryoblastic leukemia accompanying Down syndrome.", "journal": "Leukemia", "date": "2006", "authors": "Xu G, Kanezaki R, Toki T, Watanabe S, Takahashi Y, Terui K, Kitabayashi I, Ito E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "16628190", "url": "https://glygen.org/publication/PubMed/16628190" } ] }, { "title": "Phosphorylation of cortactin by p21-activated kinase.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Webb BA, Zhou S, Eves R, Shen L, Jia L, Mak AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "16854367", "url": "https://glygen.org/publication/PubMed/16854367" } ] }, { "title": "Interaction between ROCK II and nucleophosmin/B23 in the regulation of centrosome duplication.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Ma Z, Kanai M, Kawamura K, Kaibuchi K, Ye K, Fukasawa K", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "17015463", "url": "https://glygen.org/publication/PubMed/17015463" } ] }, { "title": "Bioactivation of nitroglycerin by the mitochondrial aldehyde dehydrogenase.", "journal": "Trends in cardiovascular medicine", "date": "2006", "authors": "Chen Z, Stamler JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "17055381", "url": "https://glygen.org/publication/PubMed/17055381" } ] }, { "title": "Regulation of myosin II dynamics by phosphorylation and dephosphorylation of its light chain in epithelial cells.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Watanabe T, Hosoya H, Yonemura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "17151359", "url": "https://glygen.org/publication/PubMed/17151359" } ] }, { "title": "Up-regulation of myometrial RHO effector proteins (PKN1 and DIAPH1) and CPI-17 (PPP1R14A) phosphorylation in human pregnancy is associated with increased GTP-RHOA in spontaneous preterm labor.", "journal": "Biology of reproduction", "date": "2007", "authors": "Lartey J, Smith M, Pawade J, Strachan B, Mellor H, Lopez Bernal A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "17301291", "url": "https://glygen.org/publication/PubMed/17301291" } ] }, { "title": "The Rac1 polybasic region is required for interaction with its effector PRK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Modha R, Campbell LJ, Nietlispach D, Buhecha HR, Owen D, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "18006505", "url": "https://glygen.org/publication/PubMed/18006505" } ] }, { "title": "ErbB-2 and met reciprocally regulate cellular signaling via plexin-B1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Swiercz JM, Worzfeld T, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "18025083", "url": "https://glygen.org/publication/PubMed/18025083" } ] }, { "title": "Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity.", "journal": "Genes & development", "date": "2008", "authors": "Zhao X, Jankovic V, Gural A, Huang G, Pardanani A, Menendez S, Zhang J, Dunne R, Xiao A, Erdjument-Bromage H, Allis CD, Tempst P, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "18316480", "url": "https://glygen.org/publication/PubMed/18316480" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "P24844-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844-1" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P24844-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.", "journal": "Journal of proteome research", "date": "2008", "authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ", "evidence": [ { "database": "iPTMnet", "id": "P24844-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844-1" } ], "reference": [ { "type": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ] }, { "title": "Validation of the p21-activated kinases as targets for inhibition in neurofibromatosis type 2.", "journal": "Cancer research", "date": "2008", "authors": "Yi C, Wilker EW, Yaffe MB, Stemmer-Rachamimov A, Kissil JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "18829550", "url": "https://glygen.org/publication/PubMed/18829550" } ] }, { "title": "A tripartite complex containing MRCK modulates lamellar actomyosin retrograde flow.", "journal": "Cell", "date": "2008", "authors": "Tan I, Yong J, Dong JM, Lim L, Leung T", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "18854160", "url": "https://glygen.org/publication/PubMed/18854160" } ] }, { "title": "Molecular pharmacology of human Cav3.2 T-type Ca2+ channels: block by antihypertensives, antiarrhythmics, and their analogs.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2009", "authors": "Perez-Reyes E, Van Deusen AL, Vitko I", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "18974361", "url": "https://glygen.org/publication/PubMed/18974361" } ] }, { "title": "A regulatory interplay between miR-27a and Runx1 during megakaryopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ben-Ami O, Pencovich N, Lotem J, Levanon D, Groner Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "19114653", "url": "https://glygen.org/publication/PubMed/19114653" } ] }, { "title": "Erbin and the NF2 tumor suppressor Merlin cooperatively regulate cell-type-specific activation of PAK2 by TGF-beta.", "journal": "Developmental cell", "date": "2009", "authors": "Wilkes MC, Repellin CE, Hong M, Bracamonte M, Penheiter SG, Borg JP, Leof EB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "19289088", "url": "https://glygen.org/publication/PubMed/19289088" } ] }, { "title": "The molecular anatomy of caldesmon.", "journal": "The Biochemical journal", "date": "1991", "authors": "Marston SB, Redwood CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "1930128", "url": "https://glygen.org/publication/PubMed/1930128" } ] }, { "title": "Membrane repair defects in muscular dystrophy are linked to altered interaction between MG53, caveolin-3, and dysferlin.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Cai C, Weisleder N, Ko JK, Komazaki S, Sunada Y, Nishi M, Takeshima H, Ma J", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "19380584", "url": "https://glygen.org/publication/PubMed/19380584" } ] }, { "title": "Thrombospondin-1 is a transcriptional repression target of PRMT6.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Michaud-Levesque J, Richard S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "19509293", "url": "https://glygen.org/publication/PubMed/19509293" } ] }, { "title": "Involvement of Rac/Cdc42/PAK pathway in cytoskeletal rearrangements.", "journal": "Acta biochimica Polonica", "date": "2009", "authors": "Szczepanowska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "19513348", "url": "https://glygen.org/publication/PubMed/19513348" } ] }, { "title": "Quantitative analysis of phosphopeptides in search of the disease biomarker from the hepatocellular carcinoma specimen.", "journal": "Proteomics", "date": "2009", "authors": "Lee HJ, Na K, Kwon MS, Kim H, Kim KS, Paik YK", "evidence": [ { "database": "iPTMnet", "id": "P24844-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844-1" } ], "reference": [ { "type": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P24844-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Regulation of the interaction between protein kinase C-related protein kinase 2 (PRK2) and its upstream kinase, 3-phosphoinositide-dependent protein kinase 1 (PDK1).", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Dettori R, Sonzogni S, Meyer L, Lopez-Garcia LA, Morrice NA, Zeuzem S, Engel M, Piiper A, Neimanis S, Frodin M, Biondi RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "19723632", "url": "https://glygen.org/publication/PubMed/19723632" } ] }, { "title": "Non-muscle myosin II takes centre stage in cell adhesion and migration.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Vicente-Manzanares M, Ma X, Adelstein RS, Horwitz AR", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "19851336", "url": "https://glygen.org/publication/PubMed/19851336" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P24844-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P24844-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "AML1 is overexpressed in patients with myeloproliferative neoplasms and mediates JAK2V617F-independent overexpression of NF-E2.", "journal": "Blood", "date": "2010", "authors": "Wang W, Schwemmers S, Hexner EO, Pahl HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "20339092", "url": "https://glygen.org/publication/PubMed/20339092" } ] }, { "title": "Pak1 phosphorylation enhances cortactin-N-WASP interaction in clathrin-caveolin-independent endocytosis.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Grassart A, Meas-Yedid V, Dufour A, Olivo-Marin JC, Dautry-Varsat A, Sauvonnet N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "20444238", "url": "https://glygen.org/publication/PubMed/20444238" } ] }, { "title": "Regulation of platelet myosin light chain (MYL9) by RUNX1: implications for thrombocytopenia and platelet dysfunction in RUNX1 haplodeficiency.", "journal": "Blood", "date": "2010", "authors": "Jalagadugula G, Mao G, Kaur G, Goldfinger LE, Dhanasekaran DN, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "20876458", "url": "https://glygen.org/publication/PubMed/20876458" } ] }, { "title": "CAMDI, a novel disrupted in schizophrenia 1 (DISC1)-binding protein, is required for radial migration.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Fukuda T, Sugita S, Inatome R, Yanagi S", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "20956536", "url": "https://glygen.org/publication/PubMed/20956536" } ] }, { "title": "Caspase-activated ROCK-1 allows erythroblast terminal maturation independently of cytokine-induced Rho signaling.", "journal": "Cell Death Differ.", "date": "2011", "authors": "Gabet AS, Coulon S, Fricot A, Vandekerckhove J, Chang Y, Ribeil JA, Lordier L, Zermati Y, Asnafi V, Belaid Z, Debili N, Vainchenker W, Varet B, Hermine O, Courtois G", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "21072057", "url": "https://glygen.org/publication/PubMed/21072057" } ] }, { "title": "Mechanistic studies of the autoactivation of PAK2: a two-step model of cis initiation followed by trans amplification.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wang J, Wu JW, Wang ZX", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "21098037", "url": "https://glygen.org/publication/PubMed/21098037" } ] }, { "title": "Mechanism of platelet factor 4 (PF4) deficiency with RUNX1 haplodeficiency: RUNX1 is a transcriptional regulator of PF4.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2011", "authors": "Aneja K, Jalagadugula G, Mao G, Singh A, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21129147", "url": "https://glygen.org/publication/PubMed/21129147" } ] }, { "title": "Platelet protein kinase C-theta deficiency with human RUNX1 mutation: PRKCQ is a transcriptional target of RUNX1.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2011", "authors": "Jalagadugula G, Mao G, Kaur G, Dhanasekaran DN, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21252065", "url": "https://glygen.org/publication/PubMed/21252065" } ] }, { "title": "Mutational analysis reveals a single binding interface between RhoA and its effector, PRK1.", "journal": "Biochemistry", "date": "2011", "authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "21351730", "url": "https://glygen.org/publication/PubMed/21351730" } ] }, { "title": "New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform.", "journal": "PLoS ONE", "date": "2011", "authors": "Shoval Y, Berissi H, Kimchi A, Pietrokovski S", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "21408167", "url": "https://glygen.org/publication/PubMed/21408167" } ] }, { "title": "Chelerythrine perturbs lamellar actomyosin filaments by selective inhibition of myotonic dystrophy kinase-related Cdc42-binding kinase.", "journal": "FEBS Lett.", "date": "2011", "authors": "Tan I, Lai J, Yong J, Li SF, Leung T", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "21457715", "url": "https://glygen.org/publication/PubMed/21457715" } ] }, { "title": "Down-regulation of the RUNX1-target gene NR4A3 contributes to hematopoiesis deregulation in familial platelet disorder/acute myelogenous leukemia.", "journal": "Blood", "date": "2011", "authors": "Bluteau D, Gilles L, Hilpert M, Antony-Debre I, James C, Debili N, Camara-Clayette V, Wagner-Ballon O, Cordette-Lagarde V, Robert T, Ripoche H, Gonin P, Swierczek S, Prchal J, Vainchenker W, Favier R, Raslova H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21725049", "url": "https://glygen.org/publication/PubMed/21725049" } ] }, { "title": "Site recognition and substrate screens for PKN family proteins.", "journal": "The Biochemical journal", "date": "2011", "authors": "Collazos A, Michael N, Whelan RD, Kelly G, Mellor H, Pang LC, Totty N, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "21749319", "url": "https://glygen.org/publication/PubMed/21749319" } ] }, { "title": "Analysis of the role of Ser1/Ser2/Thr9 phosphorylation on myosin II assembly and function in live cells.", "journal": "BMC cell biology", "date": "2011", "authors": "Beach JR, Licate LS, Crish JF, Egelhoff TT", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "22136066", "url": "https://glygen.org/publication/PubMed/22136066" } ] }, { "title": "p27(Kip1) controls cytokinesis via the regulation of citron kinase activation.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Serres MP, Kossatz U, Chi Y, Roberts JM, Malek NP, Besson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "22293177", "url": "https://glygen.org/publication/PubMed/22293177" } ] }, { "title": "In vivo imaging of molecular interactions at damaged sarcolemma.", "journal": "Developmental cell", "date": "2012", "authors": "Roostalu U, Strahle U", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "22421042", "url": "https://glygen.org/publication/PubMed/22421042" } ] }, { "title": "Histone arginine methylation keeps RUNX1 target genes in an intermediate state.", "journal": "Oncogene", "date": "2013", "authors": "Herglotz J, Kuvardina ON, Kolodziej S, Kumar A, Hussong H, Grez M, Lausen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "22777353", "url": "https://glygen.org/publication/PubMed/22777353" } ] }, { "title": "Cinaciguat, a soluble guanylate cyclase activator, unloads the heart but also causes hypotension in acute decompensated heart failure.", "journal": "European heart journal", "date": "2013", "authors": "Erdmann E, Semigran MJ, Nieminen MS, Gheorghiade M, Agrawal R, Mitrovic V, Mebazaa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "22778174", "url": "https://glygen.org/publication/PubMed/22778174" } ] }, { "title": "Biphasic regulation of myosin light chain phosphorylation by p21-activated kinase modulates intestinal smooth muscle contractility.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Chu J, Pham NT, Olate N, Kislitsyna K, Day MC, LeTourneau PA, Kots A, Stewart RH, Laine GA, Cox CS Jr, Uray K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "23161543", "url": "https://glygen.org/publication/PubMed/23161543" } ] }, { "title": "Citron kinase mediates transition from constriction to abscission through its coiled-coil domain.", "journal": "Journal of cell science", "date": "2013", "authors": "Watanabe S, De Zan T, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "23444367", "url": "https://glygen.org/publication/PubMed/23444367" } ] }, { "title": "Citron kinase controls a molecular network required for midbody formation in cytokinesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Bassi ZI, Audusseau M, Riparbelli MG, Callaini G, D'Avino PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "23716662", "url": "https://glygen.org/publication/PubMed/23716662" } ] }, { "title": "Low threshold T-type calcium channels as targets for novel epilepsy treatments.", "journal": "British journal of clinical pharmacology", "date": "2014", "authors": "Powell KL, Cain SM, Snutch TP, O'Brien TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "23834404", "url": "https://glygen.org/publication/PubMed/23834404" } ] }, { "title": "Differential binding of RhoA, RhoB, and RhoC to protein kinase C-related kinase (PRK) isoforms PRK1, PRK2, and PRK3: PRKs have the highest affinity for RhoB.", "journal": "Biochemistry", "date": "2013", "authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "24128008", "url": "https://glygen.org/publication/PubMed/24128008" } ] }, { "title": "Merlin sumoylation is required for its tumor suppressor activity.", "journal": "Oncogene", "date": "2014", "authors": "Qi Q, Liu X, Brat DJ, Ye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "24166499", "url": "https://glygen.org/publication/PubMed/24166499" } ] }, { "title": "A Trio-Rac1-Pak1 signalling axis drives invadopodia disassembly.", "journal": "Nature cell biology", "date": "2014", "authors": "Moshfegh Y, Bravo-Cordero JJ, Miskolci V, Condeelis J, Hodgson L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "24859002", "url": "https://glygen.org/publication/PubMed/24859002" } ] }, { "title": "Calcium channel blockers in cardiovascular pharmacotherapy.", "journal": "Journal of cardiovascular pharmacology and therapeutics", "date": "2014", "authors": "Godfraind T", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "24872348", "url": "https://glygen.org/publication/PubMed/24872348" } ] }, { "title": "Characterization and differential expression of human vascular smooth muscle myosin light chain 2 isoform in nonmuscle cells.", "journal": "Biochemistry", "date": "1989", "authors": "Kumar CC, Mohan SR, Zavodny PJ, Narula SK, Leibowitz PJ", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "2526655", "url": "https://glygen.org/publication/PubMed/2526655" } ] }, { "title": "Loss of RUNX1/AML1 arginine-methylation impairs peripheral T cell homeostasis.", "journal": "British journal of haematology", "date": "2015", "authors": "Mizutani S, Yoshida T, Zhao X, Nimer SD, Taniwaki M, Okuda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "26010396", "url": "https://glygen.org/publication/PubMed/26010396" } ] }, { "title": "The Physiology, Pathology, and Pharmacology of Voltage-Gated Calcium Channels and Their Future Therapeutic Potential.", "journal": "Pharmacological reviews", "date": "2015", "authors": "Zamponi GW, Striessnig J, Koschak A, Dolphin AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "26362469", "url": "https://glygen.org/publication/PubMed/26362469" } ] }, { "title": "The distribution of heavy-chain isoforms of myosin in airways smooth muscle from adult and neonate humans.", "journal": "The Biochemical journal", "date": "1989", "authors": "Mohammad MA, Sparrow MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "2764880", "url": "https://glygen.org/publication/PubMed/2764880" } ] }, { "title": "Formation of Nitric Oxide by Aldehyde Dehydrogenase-2 Is Necessary and Sufficient for Vascular Bioactivation of Nitroglycerin.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Opelt M, Eroglu E, Waldeck-Weiermair M, Russwurm M, Koesling D, Malli R, Graier WF, Fassett JT, Schrammel A, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "27679490", "url": "https://glygen.org/publication/PubMed/27679490" } ] }, { "title": "Direct comparison of tadalafil with sildenafil for the treatment of erectile dysfunction: a systematic review and meta-analysis.", "journal": "International urology and nephrology", "date": "2017", "authors": "Gong B, Ma M, Xie W, Yang X, Huang Y, Sun T, Luo Y, Huang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "28741090", "url": "https://glygen.org/publication/PubMed/28741090" } ] }, { "title": "Homozygous deletion in MYL9 expands the molecular basis of megacystis-microcolon-intestinal hypoperistalsis syndrome.", "journal": "Eur. J. Hum. Genet.", "date": "2018", "authors": "Moreno CA, Sobreira N, Pugh E, Zhang P, Steel G, Torres FR, Cavalcanti DP", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "reference": [ { "type": "PubMed", "id": "29453416", "url": "https://glygen.org/publication/PubMed/29453416" } ] }, { "title": "Effects of phosphorylation of light chain residues threonine 18 and serine 19 on the properties and conformation of smooth muscle myosin.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Ikebe M, Koretz J, Hartshorne DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "2966156", "url": "https://glygen.org/publication/PubMed/2966156" } ] }, { "title": "Identification of tumor-educated platelet biomarkers of non-small-cell lung cancer.", "journal": "OncoTargets and therapy", "date": "2018", "authors": "Sheng M, Dong Z, Xie Y", "evidence": [ { "database": "GlyGen", "id": "A0478", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "30532555", "url": "https://glygen.org/publication/PubMed/30532555" } ] }, { "title": "Identification, phosphorylation, and dephosphorylation of a second site for myosin light chain kinase on the 20,000-dalton light chain of smooth muscle myosin.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ikebe M, Hartshorne DJ, Elzinga M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "3079756", "url": "https://glygen.org/publication/PubMed/3079756" } ] }, { "title": "Compound heterozygous loss of function variants in MYL9 in a child with megacystis-microcolon-intestinal hypoperistalsis syndrome.", "journal": "Mol. Genet. Genomic Med.", "date": "2020", "authors": "Xue Y., Cox E., Walsh L., Kandler J.L., Sklirou E., Woerner A.", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "reference": [ { "type": "PubMed", "id": "33031641", "url": "https://glygen.org/publication/PubMed/33031641" } ] }, { "title": "Clinicopathological significance of MYL9 expression in pancreatic ductal adenocarcinoma.", "journal": "Cancer reports (Hoboken, N.J.)", "date": "2022-10", "authors": "Matsushita Katsunori, Kobayashi Shogo, Akita Hirofumi, Konno Masamitsu, Asai Ayumu, Noda Takehiro, Iwagami Yoshifumi, Asaoka Tadafumi, Gotoh Kunihito, Mori Masaki, Doki Yuichiro, Eguchi Hidetoshi, Ishii Hideshi", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" } ], "reference": [ { "type": "PubMed", "id": "34821071", "url": "https://glygen.org/publication/PubMed/34821071" } ] }, { "title": "Research progress in myosin light chain 9 in malignant tumors.", "journal": "Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences", "date": "2021", "authors": "You Y, Liu T, Shen J", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" } ], "reference": [ { "type": "PubMed", "id": "34911847", "url": "https://glygen.org/publication/PubMed/34911847" } ] }, { "title": "Myosin light chain 9 promotes the proliferation, invasion, migration and angiogenesis of colorectal cancer cells by binding to Yes-associated protein 1 and regulating Hippo signaling.", "journal": "Bioengineered", "date": "2022", "authors": "Feng M, Dong N, Zhou X, Ma L, Xiang R", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" } ], "reference": [ { "type": "PubMed", "id": "34974798", "url": "https://glygen.org/publication/PubMed/34974798" } ] }, { "title": "Elevated Myl9 reflects the Myl9-containing microthrombi in SARS-CoV-2-induced lung exudative vasculitis and predicts COVID-19 severity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022", "authors": "Iwamura C, Hirahara K, Kiuchi M, Ikehara S, Azuma K, Shimada T, Kuriyama S, Ohki S, Yamamoto E, Inaba Y, Shiko Y, Aoki A, Kokubo K, Hirasawa R, Hishiya T, Tsuji K, Nagaoka T, Ishikawa S, Kojima A, Mito H, Hase R, Kasahara Y, Kuriyama N, Tsukamoto T, Nakamura S, Urushibara T, Kaneda S, Sakao S, Tobiume M, Suzuki Y, Tsujiwaki M, Kubo T, Hasegawa T, Nakase H, Nishida O, Takahashi K, Baba K, Iizumi Y, Okazaki T, Kimura MY, Yoshino I, Igari H, Nakajima H, Suzuki T, Hanaoka H, Nakada TA, Ikehara Y, Yokote K, Nakayama T", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" } ], "reference": [ { "type": "PubMed", "id": "35895716", "url": "https://glygen.org/publication/PubMed/35895716" } ] }, { "title": "Multi-comparative Thermal Proteome Profiling Uncovers New O-GlcNAc Proteins in a System-wide Method.", "journal": "Analytical chemistry", "date": "2022-12-29", "authors": "Wang Guoli, Li Yang, Wang Ting, Wang Jun, Yao Jun, Yan Guoquan, Zhang Ying, Lu Haojie", "evidence": [ { "database": "O-GlcNAc Database", "id": "P24844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P24844" } ], "reference": [ { "type": "PubMed", "id": "36580660", "url": "https://glygen.org/publication/PubMed/36580660" } ] }, { "title": "Increased Myosin light chain 9 expression during Kawasaki disease vasculitis.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Kobayashi Hironobu, Kimura Motoko Y, Hasegawa Ichita, Suganuma Eisuke, Ikehara Yuzuru, Azuma Kazuhiko, Ito Toshihiro, Ebata Ryota, Kurashima Yosuke, Kawasaki Yohei, Shiko Yuki, Saito Naoki, Iwase Hirotaro, Lee Youngho, Noval Rivas Magali, Arditi Moshe, Zuka Masahiko, Hamada Hiromichi, Nakayama Toshinori", "evidence": [ { "database": "RefSeq", "id": "NP_006088", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006088" } ], "reference": [ { "type": "PubMed", "id": "36685558", "url": "https://glygen.org/publication/PubMed/36685558" } ] }, { "title": "Isoforms of myosin and actin in human, monkey and rat myometrium. Comparison of pregnant and non-pregnant uterus proteins.", "journal": "European journal of biochemistry", "date": "1986", "authors": "Cavaille F, Janmot C, Ropert S, d'Albis A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "3780718", "url": "https://glygen.org/publication/PubMed/3780718" } ] }, { "title": "Phosphorylation of smooth muscle myosin at two distinct sites by myosin light chain kinase.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Ikebe M, Hartshorne DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "3839510", "url": "https://glygen.org/publication/PubMed/3839510" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "A novel partner for the GTP-bound forms of rho and rac.", "journal": "FEBS letters", "date": "1995", "authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "8543060", "url": "https://glygen.org/publication/PubMed/8543060" } ] }, { "title": "Recognition and specificity in protein tyrosine kinase-mediated signalling.", "journal": "Trends in biochemical sciences", "date": "1995", "authors": "Songyang Z, Cantley LC", "evidence": [ { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "8578591", "url": "https://glygen.org/publication/PubMed/8578591" } ] }, { "title": "Regulation of myosin phosphatase by Rho and Rho-associated kinase (Rho-kinase)", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Kimura K, Ito M, Amano M, Chihara K, Fukata Y, Nakafuku M, Yamamori B, Feng J, Nakano T, Okawa K, Iwamatsu A, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "8662509", "url": "https://glygen.org/publication/PubMed/8662509" } ] }, { "title": "Phosphorylation and activation of myosin by Rho-associated kinase (Rho-kinase).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Amano M, Ito M, Kimura K, Fukata Y, Chihara K, Nakano T, Matsuura Y, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" } ], "reference": [ { "type": "PubMed", "id": "8702756", "url": "https://glygen.org/publication/PubMed/8702756" } ] }, { "title": "Sildenafil: an orally active type 5 cyclic GMP-specific phosphodiesterase inhibitor for the treatment of penile erectile dysfunction.", "journal": "International journal of impotence research", "date": "1996", "authors": "Boolell M, Allen MJ, Ballard SA, Gepi-Attee S, Muirhead GJ, Naylor AM, Osterloh IH, Gingell C", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "8858389", "url": "https://glygen.org/publication/PubMed/8858389" } ] }, { "title": "Mitotic and G2 checkpoint control: regulation of 14-3-3 protein binding by phosphorylation of Cdc25C on serine-216.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Peng CY, Graves PR, Thoma RS, Wu Z, Shaw AS, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9278512", "url": "https://glygen.org/publication/PubMed/9278512" } ] }, { "title": "Regulation of myosin phosphatase through phosphorylation of the myosin-binding subunit in platelet activation.", "journal": "Blood", "date": "1997", "authors": "Nakai K, Suzuki Y, Kihira H, Wada H, Fujioka M, Ito M, Nakano T, Kaibuchi K, Shiku H, Nishikawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9354661", "url": "https://glygen.org/publication/PubMed/9354661" } ] }, { "title": "Cardiovascular T-type calcium channels: physiological and pharmacological significance.", "journal": "Journal of hypertension. Supplement : official journal of the International Society of Hypertension", "date": "1997", "authors": "Triggle DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9481611", "url": "https://glygen.org/publication/PubMed/9481611" } ] }, { "title": "Interaction of Rac1 with GTPase-activating proteins and putative effectors. A comparison with Cdc42 and RhoA.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang B, Chernoff J, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "9535855", "url": "https://glygen.org/publication/PubMed/9535855" } ] }, { "title": "Effects of sildenafil on the relaxation of human corpus cavernosum tissue in vitro and on the activities of cyclic nucleotide phosphodiesterase isozymes.", "journal": "The Journal of urology", "date": "1998", "authors": "Ballard SA, Gingell CJ, Tang K, Turner LA, Price ME, Naylor AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9598563", "url": "https://glygen.org/publication/PubMed/9598563" } ] }, { "title": "Sildenafil, a novel inhibitor of phosphodiesterase type 5 in human corpus cavernosum smooth muscle cells.", "journal": "Life sciences", "date": "1998", "authors": "Moreland RB, Goldstein I, Traish A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9600334", "url": "https://glygen.org/publication/PubMed/9600334" } ] }, { "title": "Translocation of cortactin to the cell periphery is mediated by the small GTPase Rac1.", "journal": "Journal of cell science", "date": "1998", "authors": "Weed SA, Du Y, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "9683637", "url": "https://glygen.org/publication/PubMed/9683637" } ] }, { "title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9792683", "url": "https://glygen.org/publication/PubMed/9792683" } ] }, { "title": "YC-1 potentiates nitric oxide- and carbon monoxide-induced cyclic GMP effects in human platelets.", "journal": "Molecular pharmacology", "date": "1998", "authors": "Friebe A, Mullershausen F, Smolenski A, Walter U, Schultz G, Koesling D", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9855623", "url": "https://glygen.org/publication/PubMed/9855623" } ] }, { "title": "Citron binds to PSD-95 at glutamatergic synapses on inhibitory neurons in the hippocampus.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Zhang W, Vazquez L, Apperson M, Kennedy MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9870942", "url": "https://glygen.org/publication/PubMed/9870942" } ] }, { "title": "Citron, a Rho-target, interacts with PSD-95/SAP-90 at glutamatergic synapses in the thalamus.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Furuyashiki T, Fujisawa K, Fujita A, Madaule P, Uchino S, Mishina M, Bito H, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9870943", "url": "https://glygen.org/publication/PubMed/9870943" } ] }, { "title": "A human homologue of the checkpoint kinase Cds1 directly inhibits Cdc25 phosphatase.", "journal": "Current biology : CB", "date": "1999", "authors": "Blasina A, de Weyer IV, Laus MC, Luyten WH, Parker AE, McGowan CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9889122", "url": "https://glygen.org/publication/PubMed/9889122" } ] }, { "title": "Loop 6 of RhoA confers specificity for effector binding, stress fiber formation, and cellular transformation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zong H, Raman N, Mickelson-Young LA, Atkinson SJ, Quilliam LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9988689", "url": "https://glygen.org/publication/PubMed/9988689" } ] } ], "pathway": [ { "id": "hsa:10398", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10398", "resource": "KEGG Pathway" }, { "id": "R-HSA-3928663", "name": "EPHA-mediated growth cone collapse", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663", "resource": "Reactome", "description": "EPHA-mediated growth cone collapse" }, { "id": "R-HSA-416572", "name": "Sema4D induced cell migration and growth-cone collapse", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572", "resource": "Reactome", "description": "Sema4D induced cell migration and growth-cone collapse" }, { "id": "R-HSA-445355", "name": "Smooth Muscle Contraction", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355", "resource": "Reactome", "description": "Smooth Muscle Contraction" }, { "id": "R-HSA-5625740", "name": "RHO GTPases activate PKNs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740", "resource": "Reactome", "description": "RHO GTPases activate PKNs" }, { "id": "R-HSA-5625900", "name": "RHO GTPases activate CIT", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900", "resource": "Reactome", "description": "RHO GTPases activate CIT" }, { "id": "R-HSA-5627117", "name": "RHO GTPases Activate ROCKs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627117", "resource": "Reactome", "description": "RHO GTPases Activate ROCKs" }, { "id": "R-HSA-5627123", "name": "RHO GTPases activate PAKs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123", "resource": "Reactome", "description": "RHO GTPases activate PAKs" }, { "id": "R-HSA-8936459", "name": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459", "resource": "Reactome", "description": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function" } ], "orthologs": [ { "uniprot_canonical_ac": "Q64122-1", "protein_name": "Myosin regulatory light polypeptide 9", "gene_name": "Myl9", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSKRAKAKTTKKRPQSATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEXLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYRERIDKKGNFNYVEFTRILKHGAKDKDD", "length": 171 }, "evidence": [ { "id": "45231305", "url": "http://www.informatics.jax.org/homology/45231305", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9CQ19-1", "protein_name": "Myosin regulatory light polypeptide 9", "gene_name": "Myl9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD", "length": 172 }, "evidence": [ { "id": "45231305", "url": "http://www.informatics.jax.org/homology/45231305", "database": "MGI" }, { "id": "P24844", "url": "https://omabrowser.org/oma/group/P24844/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "muscle myosin complex", "id": "GO:0005859", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005859", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "cell cortex", "id": "GO:0005938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005938", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "stress fiber", "id": "GO:0001725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001725", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "Z disc", "id": "GO:0030018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030018", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "myofibril", "id": "GO:0030016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030016", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "structural constituent of muscle", "id": "GO:0008307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008307", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "myosin heavy chain binding", "id": "GO:0032036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032036", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "platelet aggregation", "id": "GO:0070527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070527", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "regulation of muscle contraction", "id": "GO:0006937", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006937", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" }, { "name": "myofibril assembly", "id": "GO:0030239", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030239", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 82, "end_pos": 84, "annotation": "n_glycosylation_sequon" }, { "start_pos": 95, "end_pos": 97, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. It is required to generate the driving force in the migration of the cells but not necessary for localization of myosin-2 at the leading edge. Phosphorylation is required for myotube formation.", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprot/P24844" }, { "database": "PubMed", "id": "21457715", "url": "https://glygen.org/publication/PubMed/21457715" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" }, { "database": "PubMed", "id": "P02612", "url": "https://glygen.org/publication/PubMed/P02612" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Lung cancer forty-eight-gene TEP liquid-biopsy panel", "biomarker_id": "A0478", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "30532555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30532555" } ], "instances": [ { "best_biomarker_type": "diagnostic", "status": "measured 48 gene expression level", "disease": { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "30532555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30532555" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 19 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 152 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }