{ "uniprot_canonical_ac": "P24385-1", "uniprot_ac": "P24385", "uniprot_id": "CCND1_HUMAN", "mass": { "chemical_mass": 33729.0, "monoisotopic_mass": 33729.0 }, "refseq": { "ac": "NP_444284", "name": "G1/S-specific cyclin-D1", "summary": "The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of human cancers. [provided by RefSeq, Dec 2019].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" }, "gene_names": [ { "name": "CCND1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P24385", "id": "P24385" }, { "name": "BCL1; D11S287E; PRAD1; U21B31", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284", "id": "NP_444284" }, { "name": "BCL1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P24385", "id": "P24385" }, { "name": "CCND1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284", "id": "NP_444284" }, { "name": "PRAD1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P24385", "id": "P24385" } ], "protein_names": [ { "name": "G1/S-specific cyclin-D1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P24385" }, { "name": "B-cell CLL/lymphoma 1; BCL-1 oncogene; PRAD1 oncogene; B-cell lymphoma 1 protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284", "id": "NP_444284" }, { "name": "B-cell lymphoma 1 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24385" }, { "name": "BCL-1 oncogene", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24385" }, { "name": "BCL-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24385" }, { "name": "G1/S-specific cyclin-D1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284", "id": "NP_444284" }, { "name": "PRAD1 oncogene", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24385" } ], "function": [ { "annotation": "CCND1-associated ceRNA network reveal the critical pathway of TPRG1-AS1-hsa-miR-363-3p-MYO1B as a prognostic marker for head and neck squamous cell carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" }, { "database": "PubMed", "id": "37481637", "url": "https://glygen.org/publication/PubMed/37481637" } ] }, { "annotation": "CircNFATC3 promotes the proliferation of gastric cancer through binding to IGF2BP3 and restricting its ubiquitination to enhance CCND1 mRNA stability. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" }, { "database": "PubMed", "id": "37340423", "url": "https://glygen.org/publication/PubMed/37340423" } ] }, { "annotation": "Cyclin D1 expression, clinicopathological characteristics, and 2-year survival rate of gastric cancer in Cipto Mangunkusumo General Hospital.", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" }, { "database": "PubMed", "id": "37635596", "url": "https://glygen.org/publication/PubMed/37635596" } ] }, { "annotation": "Epigenetic Downregulation of Hsa-miR-193b-3p Increases Cyclin D1 Expression Level and Cell Proliferation in Human Meningiomas. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" }, { "database": "PubMed", "id": "37686289", "url": "https://glygen.org/publication/PubMed/37686289" } ] }, { "annotation": "GLIS2 and CCND1 expression levels in breast cancer patients.", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" }, { "database": "PubMed", "id": "37574724", "url": "https://glygen.org/publication/PubMed/37574724" } ] }, { "annotation": "Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition (PubMed:1833066, PubMed:1827756, PubMed:8114739, PubMed:8302605, PubMed:19412162, PubMed:33854235). Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase (PubMed:1833066, PubMed:1827756, PubMed:8114739, PubMed:8302605, PubMed:19412162). Hypophosphorylates RB1 in early G(1) phase (PubMed:1833066, PubMed:1827756, PubMed:8114739, PubMed:8302605, PubMed:19412162). Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals (PubMed:1833066, PubMed:1827756, PubMed:8302605, PubMed:19412162). Also a substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity (PubMed:15241418). Component of the ternary complex, cyclin D1/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (PubMed:9106657). Exhibits transcriptional corepressor activity with INSM1 on the NEUROD1 and INS promoters in a cell cycle-independent manner (PubMed:16569215, PubMed:18417529).", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385#function" }, { "database": "PubMed", "id": "8302605", "url": "https://glygen.org/publication/PubMed/8302605" }, { "database": "PubMed", "id": "15241418", "url": "https://glygen.org/publication/PubMed/15241418" }, { "database": "PubMed", "id": "9106657", "url": "https://glygen.org/publication/PubMed/9106657" }, { "database": "PubMed", "id": "19412162", "url": "https://glygen.org/publication/PubMed/19412162" }, { "database": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" }, { "database": "PubMed", "id": "18417529", "url": "https://glygen.org/publication/PubMed/18417529" }, { "database": "PubMed", "id": "16569215", "url": "https://glygen.org/publication/PubMed/16569215" }, { "database": "PubMed", "id": "8114739", "url": "https://glygen.org/publication/PubMed/8114739" }, { "database": "PubMed", "id": "1827756", "url": "https://glygen.org/publication/PubMed/1827756" }, { "database": "PubMed", "id": "1833066", "url": "https://glygen.org/publication/PubMed/1833066" } ] }, { "annotation": "The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of human cancers. [provided by RefSeq, Dec 2019].", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" } ] } ], "disease": [ { "disease_id": "DOID:9538", "recommended_name": { "id": "DOID:9538", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9538", "name": "multiple myeloma", "description": "A myeloid neoplasm that is located_in the plasma cells in bone marrow." }, "synonyms": [ { "id": "DOID:9538", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9538", "name": "myeloma", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "plasma cell myeloma", "description": "A bone marrow-based plasma cell neoplasm characterized by a serum monoclonal protein and skeletal destruction with osteolytic lesions, pathological fractures, bone pain, hypercalcemia, and anemia. Clinical variants include non-secretory myeloma, smoldering myeloma, indolent myeloma, and plasma cell leukemia. (WHO, 2001)" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "Kahler disease", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "Kahler's disease", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "medullary plasmacytoma", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "multiple myeloma", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "multiple myeloma, resistance to, Somatic mutation", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "multiple myeloma, susceptibility to, Somatic mutation", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "multiple myeloma/plasma cell myeloma", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "myeloid neoplasm of plasma cell", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "myeloma", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "myeloma, multiple", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "myeloma, plasma cell, malignant", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "myelomatosis", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "plasma cell myeloid neoplasm", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "plasma cell myeloma", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "Al amyloidosis", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "amyloidosis, systemic", "description": "" }, { "id": "MONDO:0009693", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009693", "name": "myeloma - multiple", "description": "" }, { "id": "MIM:254500", "resource": "MIM", "url": "https://www.omim.org/entry/254500", "name": "Multiple myeloma", "description": "Multiple myeloma" } ], "evidence": [ { "id": "254500", "database": "MIM", "url": "https://www.omim.org/entry/254500" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 286, "end_pos": 286, "sequence_org": "T", "sequence_mut": "A", "comment": "Reduced interaction with the DCX(AMBRA1) complex, and subsequent ubiquitination and degradation by the proteasome. Abolished ubiquitination and subsequent degradation following DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "PubMed", "id": "19412162", "url": "https://glygen.org/publication/PubMed/19412162" }, { "database": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" }, { "database": "PubMed", "id": "33854239", "url": "https://glygen.org/publication/PubMed/33854239" }, { "database": "PubMed", "id": "33854232", "url": "https://glygen.org/publication/PubMed/33854232" } ] }, { "start_pos": 286, "end_pos": 288, "sequence_org": "TPT", "sequence_mut": "ATA", "comment": "Reduced ubiquitination and subsequent degradation by the proteasome.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "PubMed", "id": "10766840", "url": "https://glygen.org/publication/PubMed/10766840" } ] }, { "start_pos": 287, "end_pos": 287, "sequence_org": "P", "sequence_mut": "A", "comment": "Reduced interaction with the DCX(AMBRA1) complex, and subsequent ubiquitination and degradation by the proteasome.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" } ] }, { "start_pos": 287, "end_pos": 287, "sequence_org": "P", "sequence_mut": "L", "comment": "Reduced interaction with the DCX(AMBRA1) complex, and subsequent ubiquitination and degradation by the proteasome.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" } ] }, { "start_pos": 287, "end_pos": 287, "sequence_org": "P", "sequence_mut": "S", "comment": "Reduced interaction with the DCX(AMBRA1) complex, and subsequent ubiquitination and degradation by the proteasome.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "86.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "94.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "91.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "71.51", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "87.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "88.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "79.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "93.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "94.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P24385", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P24385" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "common_name": "Human" } ], "gene": [ { "name": "CCND1", "url": "https://www.uniprot.org/uniprot/P24385", "locus": { "chromosome": "11", "start_pos": 69654474, "end_pos": 69641156, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000110092", "url": "https://www.ensembl.org/id/ENSG00000110092" } ] } } ], "crossref": [ { "id": "ENSG00000110092", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110092", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20573", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20573", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20576", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20576", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3610", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3610", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CCND1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CCND1", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "595", "url": "https://www.ncbi.nlm.nih.gov/gene/595", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1582", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1582", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P24385", "url": "https://www.ebi.ac.uk/intact/interactors/id:P24385*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004367", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004367", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006671", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006671", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013763", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013763", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036915", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036915", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039361", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039361", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:595", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:595", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "168461", "url": "http://www.omim.org/entry/168461", "database": "MIM", "categories": [ "Other" ] }, { "id": "254500", "url": "http://www.omim.org/entry/254500", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P24385", "url": "https://www.nextprot.org/entry/NX_P24385", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "P24385", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P24385", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PCELLQM", "url": "https://omabrowser.org/oma/group/PCELLQM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1077601at2759", "url": "http://www.orthodb.org/?query=1077601at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10177", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10177", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10177:SF67", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10177:SF67", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2W96", "url": "https://www.rcsb.org/structure/2W96", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2W99", "url": "https://www.rcsb.org/structure/2W99", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2W9F", "url": "https://www.rcsb.org/structure/2W9F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2W9Z", "url": "https://www.rcsb.org/structure/2W9Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VZU", "url": "https://www.rcsb.org/structure/5VZU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P8E", "url": "https://www.rcsb.org/structure/6P8E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P8F", "url": "https://www.rcsb.org/structure/6P8F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P8G", "url": "https://www.rcsb.org/structure/6P8G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P8H", "url": "https://www.rcsb.org/structure/6P8H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00134", "url": "http://pfam.xfam.org/family/PF00134", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02984", "url": "http://pfam.xfam.org/family/PF02984", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P24385", "url": "https://pharos.nih.gov/targets/P24385", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P24385", "url": "http://purl.obolibrary.org/obo/PR_P24385", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8849470", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849470", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8951430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8951936", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951936", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F5H437", "url": "https://www.uniprot.org/uniprot/F5H437", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H437-1", "url": "https://www.uniprot.org/uniprot/F5H437-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P24385-1", "url": "https://www.uniprot.org/uniprot/P24385-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI", "length": 295, "header": "sp|P24385-1|CCND1_HUMAN Isoform 1 of G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1 CANONICAL=P24385-1" }, "isoforms": [ { "isoform_ac": "F5H437-1", "url": "", "sequence": { "sequence": "MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEM", "length": 67, "header": "tr|F5H437-1|CCND1_HUMAN Computationally mapped isoform of G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1 CANONICAL=P24385-1" }, "locus": { "chromosome": "11", "start_pos": 69647996, "end_pos": 69641314, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000536559.1", "url": "https://www.ensembl.org/id/ENST00000536559.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000438482.1", "url": "https://www.ensembl.org/id/ENSP00000438482.1" } ] } }, { "isoform_ac": "P24385-1", "url": "", "sequence": { "sequence": "MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI", "length": 295, "header": "sp|P24385-1|CCND1_HUMAN Isoform 1 of G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1 CANONICAL=P24385-1" }, "locus": { "chromosome": "11", "start_pos": 69651279, "end_pos": 69641314, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000227507.3", "url": "https://www.ensembl.org/id/ENST00000227507.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000227507.2", "url": "https://www.ensembl.org/id/ENSP00000227507.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P24385", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P24385" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30853938", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30853938" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 197, "end_pos": 197, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "8058338", "url": "https://glygen.org/publication/PubMed/8058338" } ], "site_lbl": "Ser197" }, { "start_pos": 197, "end_pos": 197, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P24385", "url": "http://phospho.elm.eu.org/byAccession/P24385.html" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "8058338", "url": "https://glygen.org/publication/PubMed/8058338" } ], "site_lbl": "Ser197" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "8058338", "url": "https://glygen.org/publication/PubMed/8058338" } ], "site_lbl": "Ser234" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P24385", "url": "http://phospho.elm.eu.org/byAccession/P24385.html" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "8058338", "url": "https://glygen.org/publication/PubMed/8058338" } ], "site_lbl": "Ser234" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "O15111-1", "kinase_gene_name": "CHUK", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "16103118", "url": "https://glygen.org/publication/PubMed/16103118" } ], "site_lbl": "Thr286" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "10910956", "url": "https://glygen.org/publication/PubMed/10910956" }, { "database": "PubMed", "id": "9832503", "url": "https://glygen.org/publication/PubMed/9832503" }, { "database": "PubMed", "id": "16504004", "url": "https://glygen.org/publication/PubMed/16504004" }, { "database": "PubMed", "id": "23552696", "url": "https://glygen.org/publication/PubMed/23552696" } ], "site_lbl": "Thr286" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "Q13627-1", "kinase_gene_name": "DYRK1A", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "24119401", "url": "https://glygen.org/publication/PubMed/24119401" } ], "site_lbl": "Thr286" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "Q9Y463-1", "kinase_gene_name": "DYRK1B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "24134204", "url": "https://glygen.org/publication/PubMed/24134204" } ], "site_lbl": "Thr286" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "PubMed", "id": "19412162", "url": "https://glygen.org/publication/PubMed/19412162" }, { "database": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "33854239", "url": "https://glygen.org/publication/PubMed/33854239" }, { "database": "PubMed", "id": "33854232", "url": "https://glygen.org/publication/PubMed/33854232" }, { "database": "phospho.ELM", "id": "P24385", "url": "http://phospho.elm.eu.org/byAccession/P24385.html" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "10766840", "url": "https://glygen.org/publication/PubMed/10766840" }, { "database": "PubMed", "id": "9832503", "url": "https://glygen.org/publication/PubMed/9832503" }, { "database": "PubMed", "id": "16103118", "url": "https://glygen.org/publication/PubMed/16103118" }, { "database": "PRO", "id": "P24385", "url": "http://purl.obolibrary.org/obo/P24385" }, { "database": "PubMed", "id": "10952989", "url": "https://glygen.org/publication/PubMed/10952989" }, { "database": "PubMed", "id": "11751903", "url": "https://glygen.org/publication/PubMed/11751903" }, { "database": "PubMed", "id": "14612495", "url": "https://glygen.org/publication/PubMed/14612495" }, { "database": "PubMed", "id": "15513923", "url": "https://glygen.org/publication/PubMed/15513923" }, { "database": "PubMed", "id": "15735756", "url": "https://glygen.org/publication/PubMed/15735756" }, { "database": "PubMed", "id": "16153639", "url": "https://glygen.org/publication/PubMed/16153639" }, { "database": "PubMed", "id": "16504004", "url": "https://glygen.org/publication/PubMed/16504004" }, { "database": "PubMed", "id": "16732330", "url": "https://glygen.org/publication/PubMed/16732330" }, { "database": "PubMed", "id": "16942622", "url": "https://glygen.org/publication/PubMed/16942622" }, { "database": "PubMed", "id": "17046823", "url": "https://glygen.org/publication/PubMed/17046823" }, { "database": "PubMed", "id": "17081987", "url": "https://glygen.org/publication/PubMed/17081987" }, { "database": "PubMed", "id": "17205132", "url": "https://glygen.org/publication/PubMed/17205132" }, { "database": "PubMed", "id": "17359980", "url": "https://glygen.org/publication/PubMed/17359980" }, { "database": "PubMed", "id": "18063576", "url": "https://glygen.org/publication/PubMed/18063576" }, { "database": "PubMed", "id": "18328826", "url": "https://glygen.org/publication/PubMed/18328826" }, { "database": "PubMed", "id": "18606783", "url": "https://glygen.org/publication/PubMed/18606783" }, { "database": "PubMed", "id": "18769147", "url": "https://glygen.org/publication/PubMed/18769147" }, { "database": "PubMed", "id": "18818515", "url": "https://glygen.org/publication/PubMed/18818515" }, { "database": "PubMed", "id": "18838555", "url": "https://glygen.org/publication/PubMed/18838555" }, { "database": "PubMed", "id": "19071090", "url": "https://glygen.org/publication/PubMed/19071090" }, { "database": "PubMed", "id": "19374252", "url": "https://glygen.org/publication/PubMed/19374252" }, { "database": "PubMed", "id": "19767775", "url": "https://glygen.org/publication/PubMed/19767775" }, { "database": "PubMed", "id": "19903334", "url": "https://glygen.org/publication/PubMed/19903334" }, { "database": "PubMed", "id": "20394812", "url": "https://glygen.org/publication/PubMed/20394812" }, { "database": "PubMed", "id": "20655656", "url": "https://glygen.org/publication/PubMed/20655656" }, { "database": "PubMed", "id": "21241249", "url": "https://glygen.org/publication/PubMed/21241249" }, { "database": "PubMed", "id": "21347341", "url": "https://glygen.org/publication/PubMed/21347341" }, { "database": "PubMed", "id": "21411630", "url": "https://glygen.org/publication/PubMed/21411630" }, { "database": "PubMed", "id": "22069692", "url": "https://glygen.org/publication/PubMed/22069692" }, { "database": "PubMed", "id": "22266466", "url": "https://glygen.org/publication/PubMed/22266466" }, { "database": "PubMed", "id": "23162706", "url": "https://glygen.org/publication/PubMed/23162706" }, { "database": "PubMed", "id": "23733133", "url": "https://glygen.org/publication/PubMed/23733133" }, { "database": "PubMed", "id": "23949314", "url": "https://glygen.org/publication/PubMed/23949314" }, { "database": "PubMed", "id": "24280698", "url": "https://glygen.org/publication/PubMed/24280698" }, { "database": "PubMed", "id": "25142862", "url": "https://glygen.org/publication/PubMed/25142862" }, { "database": "PubMed", "id": "25479723", "url": "https://glygen.org/publication/PubMed/25479723" }, { "database": "PubMed", "id": "25603341", "url": "https://glygen.org/publication/PubMed/25603341" }, { "database": "PubMed", "id": "25615593", "url": "https://glygen.org/publication/PubMed/25615593" }, { "database": "PubMed", "id": "26121043", "url": "https://glygen.org/publication/PubMed/26121043" }, { "database": "PubMed", "id": "26157550", "url": "https://glygen.org/publication/PubMed/26157550" }, { "database": "PubMed", "id": "26926171", "url": "https://glygen.org/publication/PubMed/26926171" }, { "database": "PubMed", "id": "27424123", "url": "https://glygen.org/publication/PubMed/27424123" }, { "database": "PubMed", "id": "27670681", "url": "https://glygen.org/publication/PubMed/27670681" }, { "database": "PubMed", "id": "27713153", "url": "https://glygen.org/publication/PubMed/27713153" }, { "database": "PubMed", "id": "27854312", "url": "https://glygen.org/publication/PubMed/27854312" }, { "database": "PubMed", "id": "28035994", "url": "https://glygen.org/publication/PubMed/28035994" }, { "database": "PubMed", "id": "28870200", "url": "https://glygen.org/publication/PubMed/28870200" }, { "database": "PubMed", "id": "29039762", "url": "https://glygen.org/publication/PubMed/29039762" }, { "database": "PubMed", "id": "29298515", "url": "https://glygen.org/publication/PubMed/29298515" }, { "database": "PubMed", "id": "29328502", "url": "https://glygen.org/publication/PubMed/29328502" }, { "database": "PubMed", "id": "29442024", "url": "https://glygen.org/publication/PubMed/29442024" }, { "database": "PubMed", "id": "29554905", "url": "https://glygen.org/publication/PubMed/29554905" }, { "database": "PubMed", "id": "29969496", "url": "https://glygen.org/publication/PubMed/29969496" }, { "database": "PubMed", "id": "30157875", "url": "https://glygen.org/publication/PubMed/30157875" }, { "database": "PubMed", "id": "30224477", "url": "https://glygen.org/publication/PubMed/30224477" }, { "database": "PubMed", "id": "30736789", "url": "https://glygen.org/publication/PubMed/30736789" }, { "database": "PubMed", "id": "31262325", "url": "https://glygen.org/publication/PubMed/31262325" }, { "database": "PubMed", "id": "31484966", "url": "https://glygen.org/publication/PubMed/31484966" }, { "database": "PubMed", "id": "31991293", "url": "https://glygen.org/publication/PubMed/31991293" }, { "database": "PubMed", "id": "32338437", "url": "https://glygen.org/publication/PubMed/32338437" }, { "database": "PubMed", "id": "32700164", "url": "https://glygen.org/publication/PubMed/32700164" }, { "database": "PubMed", "id": "32944401", "url": "https://glygen.org/publication/PubMed/32944401" }, { "database": "PubMed", "id": "33046973", "url": "https://glygen.org/publication/PubMed/33046973" }, { "database": "PubMed", "id": "33139730", "url": "https://glygen.org/publication/PubMed/33139730" }, { "database": "PubMed", "id": "33521925", "url": "https://glygen.org/publication/PubMed/33521925" } ], "site_lbl": "Thr286" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "17046823", "url": "https://glygen.org/publication/PubMed/17046823" } ], "site_lbl": "Thr288" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "Q9Y463-1", "kinase_gene_name": "DYRK1B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "15075324", "url": "https://glygen.org/publication/PubMed/15075324" }, { "database": "PubMed", "id": "22711815", "url": "https://glygen.org/publication/PubMed/22711815" }, { "database": "PubMed", "id": "17046823", "url": "https://glygen.org/publication/PubMed/17046823" } ], "site_lbl": "Thr288" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "24134204", "url": "https://glygen.org/publication/PubMed/24134204" }, { "database": "PubMed", "id": "24280698", "url": "https://glygen.org/publication/PubMed/24280698" } ], "site_lbl": "Thr288" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "8058338", "url": "https://glygen.org/publication/PubMed/8058338" } ], "site_lbl": "Ser90" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P24385", "url": "http://phospho.elm.eu.org/byAccession/P24385.html" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "8058338", "url": "https://glygen.org/publication/PubMed/8058338" } ], "site_lbl": "Ser90" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor.", "journal": "Cell", "date": "1999", "authors": "Brunet A, Bonni A, Zigmond MJ, Lin MZ, Juo P, Hu LS, Anderson MJ, Arden KC, Blenis J, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10102273", "url": "https://glygen.org/publication/PubMed/10102273" } ] }, { "title": "Beta-catenin regulates expression of cyclin D1 in colon carcinoma cells.", "journal": "Nature", "date": "1999", "authors": "Tetsu O, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430" } ], "reference": [ { "type": "PubMed", "id": "10201372", "url": "https://glygen.org/publication/PubMed/10201372" } ] }, { "title": "Cumulative effect of phosphorylation of pRB on regulation of E2F activity.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Brown VD, Phillips RA, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "10207050", "url": "https://glygen.org/publication/PubMed/10207050" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "E2F mediates developmental and cell cycle regulation of ORC1 in Drosophila.", "journal": "The EMBO journal", "date": "1999", "authors": "Asano M, Wharton RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "10228158", "url": "https://glygen.org/publication/PubMed/10228158" } ] }, { "title": "Non-transcriptional action of oestradiol and progestin triggers DNA synthesis.", "journal": "The EMBO journal", "date": "1999", "authors": "Castoria G, Barone MV, Di Domenico M, Bilancio A, Ametrano D, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10228164", "url": "https://glygen.org/publication/PubMed/10228164" } ] }, { "title": "The cyclin D1 gene is a target of the beta-catenin/LEF-1 pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Shtutman M, Zhurinsky J, Simcha I, Albanese C, D'Amico M, Pestell R, Ben-Ze'ev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430" } ], "reference": [ { "type": "PubMed", "id": "10318916", "url": "https://glygen.org/publication/PubMed/10318916" } ] }, { "title": "Ubiquitination of p27 is regulated by Cdk-dependent phosphorylation and trimeric complex formation.", "journal": "Genes & development", "date": "1999", "authors": "Montagnoli A, Fiore F, Eytan E, Carrano AC, Draetta GF, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10323868", "url": "https://glygen.org/publication/PubMed/10323868" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "p27(Kip1) ubiquitination and degradation is regulated by the SCF(Skp2) complex through phosphorylated Thr187 in p27.", "journal": "Current biology : CB", "date": "1999", "authors": "Tsvetkov LM, Yeh KH, Lee SJ, Sun H, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10375532", "url": "https://glygen.org/publication/PubMed/10375532" } ] }, { "title": "CDK inhibitors: positive and negative regulators of G1-phase progression.", "journal": "Genes & development", "date": "1999", "authors": "Sherr CJ, Roberts JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "10385618", "url": "https://glygen.org/publication/PubMed/10385618" } ] }, { "title": "CDC25A phosphatase is a target of E2F and is required for efficient E2F-induced S phase.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Vigo E, Muller H, Prosperini E, Hateboer G, Cartwright P, Moroni MC, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "10454584", "url": "https://glygen.org/publication/PubMed/10454584" } ] }, { "title": "Cdk phosphorylation triggers sequential intramolecular interactions that progressively block Rb functions as cells move through G1.", "journal": "Cell", "date": "1999", "authors": "Harbour JW, Luo RX, Dei Santi A, Postigo AA, Dean DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "10499802", "url": "https://glygen.org/publication/PubMed/10499802" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Mechanisms of transcriptional activation of bcl-2 gene expression by 17beta-estradiol in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Dong L, Wang W, Wang F, Stoner M, Reed JC, Harigai M, Samudio I, Kladde MP, Vyhlidal C, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10542244", "url": "https://glygen.org/publication/PubMed/10542244" } ] }, { "title": "SKP2 is required for ubiquitin-mediated degradation of the CDK inhibitor p27.", "journal": "Nature cell biology", "date": "1999", "authors": "Carrano AC, Eytan E, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10559916", "url": "https://glygen.org/publication/PubMed/10559916" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "Association of Pur alpha and E2F-1 suppresses transcriptional activity of E2F-1.", "journal": "Oncogene", "date": "1999", "authors": "Darbinian N, Gallia GL, Kundu M, Shcherbik N, Tretiakova A, Giordano A, Khalili K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "10597240", "url": "https://glygen.org/publication/PubMed/10597240" } ] }, { "title": "Cdk2-dependent and -independent pathways in E2F-mediated S phase induction.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Arata Y, Fujita M, Ohtani K, Kijima S, Kato JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "10692433", "url": "https://glygen.org/publication/PubMed/10692433" } ] }, { "title": "Ubiquitination of free cyclin D1 is independent of phosphorylation on threonine 286.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Germain D, Russell A, Thompson A, Hendley J", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "10766840", "url": "https://glygen.org/publication/PubMed/10766840" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Phosphorylation at serine 10, a major phosphorylation site of p27(Kip1), increases its protein stability.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ishida N, Kitagawa M, Hatakeyama S, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10831586", "url": "https://glygen.org/publication/PubMed/10831586" } ] }, { "title": "Structural basis for the heterodimeric interaction between the acute leukaemia-associated transcription factors AML1 and CBFbeta.", "journal": "The EMBO journal", "date": "2000", "authors": "Warren AJ, Bravo J, Williams RL, Rabbitts TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "10856244", "url": "https://glygen.org/publication/PubMed/10856244" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "A potential mechanism for fumonisin B(1)-mediated hepatocarcinogenesis: cyclin D1 stabilization associated with activation of Akt and inhibition of GSK-3beta activity.", "journal": "Carcinogenesis", "date": "2000", "authors": "Ramljak D, Calvert RJ, Wiesenfeld PW, Diwan BA, Catipovic B, Marasas WF, Victor TC, Anderson LM, Gelderblom WC", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "10910956", "url": "https://glygen.org/publication/PubMed/10910956" } ] }, { "title": "Osmotic stress regulates the stability of cyclin D1 in a p38SAPK2-dependent manner.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Casanovas O, Miro F, Estanyol JM, Itarte E, Agell N, Bachs O", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "10952989", "url": "https://glygen.org/publication/PubMed/10952989" } ] }, { "title": "Inhibition of cyclin-dependent kinase 4 (Cdk4) by fascaplysin, a marine natural product.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Soni R, Muller L, Furet P, Schoepfer J, Stephan C, Zumstein-Mecker S, Fretz H, Chaudhuri B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "10973815", "url": "https://glygen.org/publication/PubMed/10973815" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "Downregulation of cyclin D1 alters cdk 4- and cdk 2-specific phosphorylation of retinoblastoma protein.", "journal": "Molecular cell biology research communications : MCBRC", "date": "2000", "authors": "Yu B, Lane ME, Pestell RG, Albanese C, Wadler S", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11032757", "url": "https://glygen.org/publication/PubMed/11032757" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "Analysis of cyclin D3-cdk4 complexes in fibroblasts expressing and lacking p27(kip1) and p21(cip1).", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Bagui TK, Jackson RJ, Agrawal D, Pledger WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11073976", "url": "https://glygen.org/publication/PubMed/11073976" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Estrogen receptor-mediated activation of the serum response element in MCF-7 cells through MAPK-dependent phosphorylation of Elk-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Duan R, Xie W, Burghardt RC, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11145955", "url": "https://glygen.org/publication/PubMed/11145955" } ] }, { "title": "Phosphorylation-dependent and -independent functions of p130 cooperate to evoke a sustained G1 block.", "journal": "The EMBO journal", "date": "2001", "authors": "Hansen K, Farkas T, Lukas J, Holm K, Ronnstrand L, Bartek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11157749", "url": "https://glygen.org/publication/PubMed/11157749" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "Cytoplasmic localization of p21Cip1/WAF1 by Akt-induced phosphorylation in HER-2/neu-overexpressing cells.", "journal": "Nature cell biology", "date": "2001", "authors": "Zhou BP, Liao Y, Xia W, Spohn B, Lee MH, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11231573", "url": "https://glygen.org/publication/PubMed/11231573" } ] }, { "title": "The cell-cycle regulatory protein Cks1 is required for SCF(Skp2)-mediated ubiquitinylation of p27.", "journal": "Nature cell biology", "date": "2001", "authors": "Ganoth D, Bornstein G, Ko TK, Larsen B, Tyers M, Pagano M, Hershko A", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "11231585", "url": "https://glygen.org/publication/PubMed/11231585" } ] }, { "title": "Reduction in cyclin D1/Cdk4/retinoblastoma protein signaling by CRE-decoy oligonucleotide.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Park YG, Park S, Lim SO, Lee MS, Ryu CK, Kim I, Cho-Chung YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11243864", "url": "https://glygen.org/publication/PubMed/11243864" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "Methylation of histone H3 by coactivator-associated arginine methyltransferase 1.", "journal": "Biochemistry", "date": "2001", "authors": "Schurter BT, Koh SS, Chen D, Bunick GJ, Harp JM, Hanson BL, Henschen-Edman A, Mackay DR, Stallcup MR, Aswad DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11341840", "url": "https://glygen.org/publication/PubMed/11341840" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Differential regulation of retinoblastoma tumor suppressor protein by G(1) cyclin-dependent kinase complexes in vivo.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Ezhevsky SA, Ho A, Becker-Hapak M, Davis PK, Dowdy SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11416152", "url": "https://glygen.org/publication/PubMed/11416152" } ] }, { "title": "Methylation of histone H4 at arginine 3 occurs in vivo and is mediated by the nuclear receptor coactivator PRMT1.", "journal": "Current biology : CB", "date": "2001", "authors": "Strahl BD, Briggs SD, Brame CJ, Caldwell JA, Koh SS, Ma H, Cook RG, Shabanowitz J, Hunt DF, Stallcup MR, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11448779", "url": "https://glygen.org/publication/PubMed/11448779" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "PI3-kinase in concert with Src promotes the S-phase entry of oestradiol-stimulated MCF-7 cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Castoria G, Migliaccio A, Bilancio A, Di Domenico M, de Falco A, Lombardi M, Fiorentino R, Varricchio L, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11689445", "url": "https://glygen.org/publication/PubMed/11689445" } ] }, { "title": "The E2F1-3 transcription factors are essential for cellular proliferation.", "journal": "Nature", "date": "2001", "authors": "Wu L, Timmers C, Maiti B, Saavedra HI, Sang L, Chong GT, Nuckolls F, Giangrande P, Wright FA, Field SJ, Greenberg ME, Orkin S, Nevins JR, Robinson ML, Leone G", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11719808", "url": "https://glygen.org/publication/PubMed/11719808" } ] }, { "title": "p27 cytoplasmic localization is regulated by phosphorylation on Ser10 and is not a prerequisite for its proteolysis.", "journal": "The EMBO journal", "date": "2001", "authors": "Rodier G, Montagnoli A, Di Marcotullio L, Coulombe P, Draetta GF, Pagano M, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11726503", "url": "https://glygen.org/publication/PubMed/11726503" } ] }, { "title": "Hormone-dependent, CARM1-directed, arginine-specific methylation of histone H3 on a steroid-regulated promoter.", "journal": "Current biology : CB", "date": "2001", "authors": "Ma H, Baumann CT, Li H, Strahl BD, Rice R, Jelinek MA, Aswad DW, Allis CD, Hager GL, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11747826", "url": "https://glygen.org/publication/PubMed/11747826" } ] }, { "title": "Methylation at arginine 17 of histone H3 is linked to gene activation.", "journal": "EMBO reports", "date": "2002", "authors": "Bauer UM, Daujat S, Nielsen SJ, Nightingale K, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11751582", "url": "https://glygen.org/publication/PubMed/11751582" } ] }, { "title": "p21(Cip1) Promotes cyclin D1 nuclear accumulation via direct inhibition of nuclear export.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Alt JR, Gladden AB, Diehl JA", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "11751903", "url": "https://glygen.org/publication/PubMed/11751903" } ] }, { "title": "A novel WD repeat protein component of the methylosome binds Sm proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Friesen WJ, Wyce A, Paushkin S, Abel L, Rappsilber J, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11756452", "url": "https://glygen.org/publication/PubMed/11756452" } ] }, { "title": "Mutations in the RUNX2 gene in patients with cleidocranial dysplasia.", "journal": "Human mutation", "date": "2002", "authors": "Otto F, Kanegane H, Mundlos S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "11857736", "url": "https://glygen.org/publication/PubMed/11857736" } ] }, { "title": "Expression of FKHR, FKHRL1, and AFX genes in the rodent ovary: evidence for regulation by IGF-I, estrogen, and the gonadotropins.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Richards JS, Sharma SC, Falender AE, Lo YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11875118", "url": "https://glygen.org/publication/PubMed/11875118" } ] }, { "title": "Reversal of growth suppression by p107 via direct phosphorylation by cyclin D1/cyclin-dependent kinase 4.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Leng X, Noble M, Adams PD, Qin J, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "11884610", "url": "https://glygen.org/publication/PubMed/11884610" } ] }, { "title": "Phosphorylation of p27Kip1 on serine 10 is required for its binding to CRM1 and nuclear export.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ishida N, Hara T, Kamura T, Yoshida M, Nakayama K, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11889117", "url": "https://glygen.org/publication/PubMed/11889117" } ] }, { "title": "E2F mediates cell cycle-dependent transcriptional repression in vivo by recruitment of an HDAC1/mSin3B corepressor complex.", "journal": "Genes & development", "date": "2002", "authors": "Rayman JB, Takahashi Y, Indjeian VB, Dannenberg JH, Catchpole S, Watson RJ, te Riele H, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "11959842", "url": "https://glygen.org/publication/PubMed/11959842" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "E2F-dependent accumulation of hEmi1 regulates S phase entry by inhibiting APC(Cdh1).", "journal": "Nature cell biology", "date": "2002", "authors": "Hsu JY, Reimann JD, Sorensen CS, Lukas J, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "11988738", "url": "https://glygen.org/publication/PubMed/11988738" } ] }, { "title": "AP-1 as a regulator of cell life and death.", "journal": "Nature cell biology", "date": "2002", "authors": "Shaulian E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11988758", "url": "https://glygen.org/publication/PubMed/11988758" } ] }, { "title": "Estrogen alters thresholds for B cell apoptosis and activation.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Grimaldi CM, Cleary J, Dagtas AS, Moussai D, Diamond B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12070310", "url": "https://glygen.org/publication/PubMed/12070310" } ] }, { "title": "The t(8;21) fusion protein, AML1 ETO, specifically represses the transcription of the p14(ARF) tumor suppressor in acute myeloid leukemia.", "journal": "Nature medicine", "date": "2002", "authors": "Linggi B, Muller-Tidow C, van de Locht L, Hu M, Nip J, Serve H, Berdel WE, van der Reijden B, Quelle DE, Rowley JD, Cleveland J, Jansen JH, Pandolfi PP, Hiebert SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951936", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951936" } ], "reference": [ { "type": "PubMed", "id": "12091906", "url": "https://glygen.org/publication/PubMed/12091906" } ] }, { "title": "A growth factor-dependent nuclear kinase phosphorylates p27(Kip1) and regulates cell cycle progression.", "journal": "The EMBO journal", "date": "2002", "authors": "Boehm M, Yoshimoto T, Crook MF, Nallamshetty S, True A, Nabel GJ, Nabel EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12093740", "url": "https://glygen.org/publication/PubMed/12093740" } ] }, { "title": "Altered affinity of CBF beta-SMMHC for Runx1 explains its role in leukemogenesis.", "journal": "Nature structural biology", "date": "2002", "authors": "Lukasik SM, Zhang L, Corpora T, Tomanicek S, Li Y, Kundu M, Hartman K, Liu PP, Laue TM, Biltonen RL, Speck NA, Bushweller JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "12172539", "url": "https://glygen.org/publication/PubMed/12172539" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "Runx2 (Cbfa1, AML-3) interacts with histone deacetylase 6 and represses the p21(CIP1/WAF1) promoter.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Westendorf JJ, Zaidi SK, Cascino JE, Kahler R, van Wijnen AJ, Lian JB, Yoshida M, Stein GS, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "12391164", "url": "https://glygen.org/publication/PubMed/12391164" } ] }, { "title": "Core-binding factor beta interacts with Runx2 and is required for skeletal development.", "journal": "Nature genetics", "date": "2002", "authors": "Yoshida CA, Furuichi T, Fujita T, Fukuyama R, Kanatani N, Kobayashi S, Satake M, Takada K, Komori T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "12434152", "url": "https://glygen.org/publication/PubMed/12434152" } ] }, { "title": "Cbfbeta interacts with Runx2 and has a critical role in bone development.", "journal": "Nature genetics", "date": "2002", "authors": "Kundu M, Javed A, Jeon JP, Horner A, Shum L, Eckhaus M, Muenke M, Lian JB, Yang Y, Nuckolls GH, Stein GS, Liu PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "12434156", "url": "https://glygen.org/publication/PubMed/12434156" } ] }, { "title": "The pRb-related protein p130 is regulated by phosphorylation-dependent proteolysis via the protein-ubiquitin ligase SCF(Skp2).", "journal": "Genes & development", "date": "2002", "authors": "Tedesco D, Lukas J, Reed SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "12435635", "url": "https://glygen.org/publication/PubMed/12435635" } ] }, { "title": "Activation of cyclin D1-kinase in murine fibroblasts lacking both p21(Cip1) and p27(Kip1).", "journal": "Oncogene", "date": "2002", "authors": "Sugimoto M, Martin N, Wilks DP, Tamai K, Huot TJ, Pantoja C, Okumura K, Serrano M, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "12444543", "url": "https://glygen.org/publication/PubMed/12444543" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "Synthesis, structure-activity relationship, and biological studies of indolocarbazoles as potent cyclin D1-CDK4 inhibitors.", "journal": "Journal of medicinal chemistry", "date": "2003", "authors": "Zhu G, Conner SE, Zhou X, Shih C, Li T, Anderson BD, Brooks HB, Campbell RM, Considine E, Dempsey JA, Faul MM, Ogg C, Patel B, Schultz RM, Spencer CD, Teicher B, Watkins SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "12747775", "url": "https://glygen.org/publication/PubMed/12747775" } ] }, { "title": "An E2F site in the 5'-promoter region contributes to serum-dependent up-regulation of the human proliferating cell nuclear antigen gene.", "journal": "FEBS letters", "date": "2003", "authors": "Li YY, Wang L, Lu CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "12782299", "url": "https://glygen.org/publication/PubMed/12782299" } ] }, { "title": "The cell cycle: a review of regulation, deregulation and therapeutic targets in cancer.", "journal": "Cell proliferation", "date": "2003", "authors": "Vermeulen K, Van Bockstaele DR, Berneman ZN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12814430", "url": "https://glygen.org/publication/PubMed/12814430" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "Estrogens down-regulate p27Kip1 in breast cancer cells through Skp2 and through nuclear export mediated by the ERK pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Foster JS, Fernando RI, Ishida N, Nakayama KI, Wimalasena J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12904306", "url": "https://glygen.org/publication/PubMed/12904306" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "Identification and properties of an atypical catalytic subunit (p34PSK-J3/cdk4) for mammalian D type G1 cyclins.", "journal": "Cell", "date": "1992", "authors": "Matsushime H, Ewen ME, Strom DK, Kato JY, Hanks SK, Roussel MF, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "1423597", "url": "https://glygen.org/publication/PubMed/1423597" } ] }, { "title": "P27Kip1 and p21Cip1 are not required for the formation of active D cyclin-cdk4 complexes.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Bagui TK, Mohapatra S, Haura E, Pledger WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "14517297", "url": "https://glygen.org/publication/PubMed/14517297" } ] }, { "title": "The cyclin D3-CDK4-p27kip1 holoenzyme in thyroid epithelial cells: activation by TSH, inhibition by TGFbeta, and phosphorylations of its subunits demonstrated by two-dimensional gel electrophoresis.", "journal": "Experimental cell research", "date": "2003", "authors": "Coulonval K, Bockstaele L, Paternot S, Dumont JE, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "14597415", "url": "https://glygen.org/publication/PubMed/14597415" } ] }, { "title": "An alternatively spliced cyclin D1 isoform, cyclin D1b, is a nuclear oncogene.", "journal": "Cancer research", "date": "2003", "authors": "Lu F, Gladden AB, Diehl JA", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "14612495", "url": "https://glygen.org/publication/PubMed/14612495" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "17beta-estradiol inhibits oxidative stress-induced apoptosis in keratinocytes by promoting Bcl-2 expression.", "journal": "The Journal of investigative dermatology", "date": "2003", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "14675202", "url": "https://glygen.org/publication/PubMed/14675202" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Regulation of Geminin and Cdt1 expression by E2F transcription factors.", "journal": "Oncogene", "date": "2004", "authors": "Yoshida K, Inoue I", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "14990995", "url": "https://glygen.org/publication/PubMed/14990995" } ] }, { "title": "p53 regulates thymic Notch1 activation.", "journal": "European journal of immunology", "date": "2004", "authors": "Laws AM, Osborne BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "14991602", "url": "https://glygen.org/publication/PubMed/14991602" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "Combinatorial gene control involving E2F and E Box family members.", "journal": "The EMBO journal", "date": "2004", "authors": "Giangrande PH, Zhu W, Rempel RE, Laakso N, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "15014447", "url": "https://glygen.org/publication/PubMed/15014447" } ] }, { "title": "A twist code determines the onset of osteoblast differentiation.", "journal": "Developmental cell", "date": "2004", "authors": "Bialek P, Kern B, Yang X, Schrock M, Sosic D, Hong N, Wu H, Yu K, Ornitz DM, Olson EN, Justice MJ, Karsenty G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "15030764", "url": "https://glygen.org/publication/PubMed/15030764" } ] }, { "title": "Mirk/dyrk1B kinase destabilizes cyclin D1 by phosphorylation at threonine 288.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Zou Y, Ewton DZ, Deng X, Mercer SE, Friedman E", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "15075324", "url": "https://glygen.org/publication/PubMed/15075324" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates c-fos up-regulation by 17beta-estradiol and phytoestrogens in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Maggiolini M, Vivacqua A, Fasanella G, Recchia AG, Sisci D, Pezzi V, Montanaro D, Musti AM, Picard D, Ando S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15090535", "url": "https://glygen.org/publication/PubMed/15090535" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "Transforming growth factor-beta stimulates p300-dependent RUNX3 acetylation, which inhibits ubiquitination-mediated degradation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Jin YH, Jeon EJ, Li QL, Lee YH, Choi JK, Kim WJ, Lee KY, Bae SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951936", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951936" } ], "reference": [ { "type": "PubMed", "id": "15138260", "url": "https://glygen.org/publication/PubMed/15138260" } ] }, { "title": "Noncatalytic requirement for cyclin A-cdk2 in p27 turnover.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zhu XH, Nguyen H, Halicka HD, Traganos F, Koff A", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "15199159", "url": "https://glygen.org/publication/PubMed/15199159" } ] }, { "title": "Cyclin-dependent kinases regulate the antiproliferative function of Smads.", "journal": "Nature", "date": "2004", "authors": "Matsuura I, Denissova NG, Wang G, He D, Long J, Liu F", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "15241418", "url": "https://glygen.org/publication/PubMed/15241418" } ] }, { "title": "17beta-estradiol stimulates the growth of human keratinocytes by inducing cyclin D2 expression.", "journal": "The Journal of investigative dermatology", "date": "2004", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15245432", "url": "https://glygen.org/publication/PubMed/15245432" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Role of atypical protein kinase C in estradiol-triggered G1/S progression of MCF-7 cells.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Castoria G, Migliaccio A, Di Domenico M, Lombardi M, de Falco A, Varricchio L, Bilancio A, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15314172", "url": "https://glygen.org/publication/PubMed/15314172" } ] }, { "title": "Physical and functional link of the leukemia-associated factors AML1 and PML.", "journal": "Blood", "date": "2005", "authors": "Nguyen LA, Pandolfi PP, Aikawa Y, Tagata Y, Ohki M, Kitabayashi I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "15331439", "url": "https://glygen.org/publication/PubMed/15331439" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "An Rb-Skp2-p27 pathway mediates acute cell cycle inhibition by Rb and is retained in a partial-penetrance Rb mutant.", "journal": "Molecular cell", "date": "2004", "authors": "Ji P, Jiang H, Rekhtman K, Bloom J, Ichetovkin M, Pagano M, Zhu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069" } ], "reference": [ { "type": "PubMed", "id": "15469821", "url": "https://glygen.org/publication/PubMed/15469821" } ] }, { "title": "Activating mutations of NOTCH1 in human T cell acute lymphoblastic leukemia.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Weng AP, Ferrando AA, Lee W, Morris JP 4th, Silverman LB, Sanchez-Irizarry C, Blacklow SC, Look AT, Aster JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "15472075", "url": "https://glygen.org/publication/PubMed/15472075" } ] }, { "title": "Human SWI/SNF-associated PRMT5 methylates histone H3 arginine 8 and negatively regulates expression of ST7 and NM23 tumor suppressor genes.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Pal S, Vishwanath SN, Erdjument-Bromage H, Tempst P, Sif S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "15485929", "url": "https://glygen.org/publication/PubMed/15485929" } ] }, { "title": "E2Fs link the control of G1/S and G2/M transcription.", "journal": "The EMBO journal", "date": "2004", "authors": "Zhu W, Giangrande PH, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "15510213", "url": "https://glygen.org/publication/PubMed/15510213" } ] }, { "title": "C-terminal sequences direct cyclin D1-CRM1 binding.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Benzeno S, Diehl JA", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "15513923", "url": "https://glygen.org/publication/PubMed/15513923" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Specific inhibition of cyclin-dependent kinase 4/6 by PD 0332991 and associated antitumor activity in human tumor xenografts.", "journal": "Molecular cancer therapeutics", "date": "2004", "authors": "Fry DW, Harvey PJ, Keller PR, Elliott WL, Meade M, Trachet E, Albassam M, Zheng X, Leopold WR, Pryer NK, Toogood PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "15542782", "url": "https://glygen.org/publication/PubMed/15542782" } ] }, { "title": "AP-1 subunits: quarrel and harmony among siblings.", "journal": "Journal of cell science", "date": "2004", "authors": "Hess J, Angel P, Schorpp-Kistner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15564374", "url": "https://glygen.org/publication/PubMed/15564374" } ] }, { "title": "Phosphorylation of p27Kip1 at Thr-157 interferes with its association with importin alpha during G1 and prevents nuclear re-entry.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shin I, Rotty J, Wu FY, Arteaga CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "15579463", "url": "https://glygen.org/publication/PubMed/15579463" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Molecular determinants of NOTCH4 transcription in vascular endothelium.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Wu J, Iwata F, Grass JA, Osborne CS, Elnitski L, Fraser P, Ohneda O, Yamamoto M, Bresnick EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "15684396", "url": "https://glygen.org/publication/PubMed/15684396" } ] }, { "title": "Integration of the extranuclear and nuclear actions of estrogen.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15705661", "url": "https://glygen.org/publication/PubMed/15705661" } ] }, { "title": "Phosphorylation of cyclin D1 at Thr 286 during S phase leads to its proteasomal degradation and allows efficient DNA synthesis.", "journal": "Oncogene", "date": "2005", "authors": "Guo Y, Yang K, Harwalkar J, Nye JM, Mason DR, Garrett MD, Hitomi M, Stacey DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "15735756", "url": "https://glygen.org/publication/PubMed/15735756" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "Estrogen-induced G1/S transition of G0-arrested estrogen-dependent breast cancer cells is regulated by mitochondrial oxidant signaling.", "journal": "Oncogene", "date": "2005", "authors": "Felty Q, Singh KP, Roy D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15897899", "url": "https://glygen.org/publication/PubMed/15897899" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "IkappaB kinase alpha regulates subcellular distribution and turnover of cyclin D1 by phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kwak YT, Li R, Becerra CR, Tripathy D, Frenkel EP, Verma UN", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "16103118", "url": "https://glygen.org/publication/PubMed/16103118" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Differentiation-inducing factor-1 induces cyclin D1 degradation through the phosphorylation of Thr286 in squamous cell carcinoma.", "journal": "Experimental cell research", "date": "2005", "authors": "Mori J, Takahashi-Yanaga F, Miwa Y, Watanabe Y, Hirata M, Morimoto S, Shirasuna K, Sasaguri T", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "16153639", "url": "https://glygen.org/publication/PubMed/16153639" } ] }, { "title": "Tyrosine phosphorylation modulates binding preference to cyclin-dependent kinases and subcellular localization of p27Kip1 in the acute promyelocytic leukemia cell line NB4.", "journal": "Blood", "date": "2006", "authors": "Kardinal C, Dangers M, Kardinal A, Koch A, Brandt DT, Tamura T, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "16195327", "url": "https://glygen.org/publication/PubMed/16195327" } ] }, { "title": "The Fos family of transcription factors and their role in tumourigenesis.", "journal": "European journal of cancer (Oxford, England : 1990)", "date": "2005", "authors": "Milde-Langosch K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16199154", "url": "https://glygen.org/publication/PubMed/16199154" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Structural basis of the Cks1-dependent recognition of p27(Kip1) by the SCF(Skp2) ubiquitin ligase.", "journal": "Molecular cell", "date": "2005", "authors": "Hao B, Zheng N, Schulman BA, Wu G, Miller JJ, Pagano M, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "16209941", "url": "https://glygen.org/publication/PubMed/16209941" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates the proliferative effects induced by 17beta-estradiol and hydroxytamoxifen in endometrial cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Recchia AG, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16239258", "url": "https://glygen.org/publication/PubMed/16239258" } ] }, { "title": "The hematopoietic transcription factor AML1 (RUNX1) is negatively regulated by the cell cycle protein cyclin D3.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Peterson LF, Boyapati A, Ranganathan V, Iwama A, Tenen DG, Tsai S, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "16287839", "url": "https://glygen.org/publication/PubMed/16287839" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "Cell cycle-dependent phosphorylation of the RUNX2 transcription factor by cdc2 regulates endothelial cell proliferation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Qiao M, Shapiro P, Fosbrink M, Rus H, Kumar R, Passaniti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "16407259", "url": "https://glygen.org/publication/PubMed/16407259" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Inhibition of S/G2 phase CDK4 reduces mitotic fidelity.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Burgess A, Wigan M, Giles N, Depinto W, Gillespie P, Stevens F, Gabrielli B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "16476733", "url": "https://glygen.org/publication/PubMed/16476733" } ] }, { "title": "Histone deacetylase inhibitor, trichostatin A induces ubiquitin-dependent cyclin D1 degradation in MCF-7 breast cancer cells.", "journal": "Molecular cancer", "date": "2006", "authors": "Alao JP, Stavropoulou AV, Lam EW, Coombes RC, Vigushin DM", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "16504004", "url": "https://glygen.org/publication/PubMed/16504004" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "INSM1 functions as a transcriptional repressor of the neuroD/beta2 gene through the recruitment of cyclin D1 and histone deacetylases.", "journal": "Biochem. J.", "date": "2006", "authors": "Wang H.W., Breslin M.B., Lan M.S., Liu W.D., Muguira M.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "16569215", "url": "https://glygen.org/publication/PubMed/16569215" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "Notch 1 activation in the molecular pathogenesis of T-cell acute lymphoblastic leukaemia.", "journal": "Nature reviews. Cancer", "date": "2006", "authors": "Grabher C, von Boehmer H, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "16612405", "url": "https://glygen.org/publication/PubMed/16612405" } ] }, { "title": "Identification of mutations that disrupt phosphorylation-dependent nuclear export of cyclin D1.", "journal": "Oncogene", "date": "2006", "authors": "Benzeno S, Lu F, Guo M, Barbash O, Zhang F, Herman JG, Klein PS, Rustgi A, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "16732330", "url": "https://glygen.org/publication/PubMed/16732330" } ] }, { "title": "Regulated activating Thr172 phosphorylation of cyclin-dependent kinase 4(CDK4): its relationship with cyclins and CDK `inhibitors`.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Bockstaele L, Kooken H, Libert F, Paternot S, Dumont JE, de Launoit Y, Roger PP, Coulonval K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "16782892", "url": "https://glygen.org/publication/PubMed/16782892" } ] }, { "title": "17beta-estradiol, genistein, and 4-hydroxytamoxifen induce the proliferation of thyroid cancer cells through the g protein-coupled receptor GPR30.", "journal": "Molecular pharmacology", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Albanito L, Madeo A, Rago V, Carpino A, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16835357", "url": "https://glygen.org/publication/PubMed/16835357" } ] }, { "title": "Glycogen synthase kinase 3 has a limited role in cell cycle regulation of cyclin D1 levels.", "journal": "BMC cell biology", "date": "2006", "authors": "Yang K, Guo Y, Stacey WC, Harwalkar J, Fretthold J, Hitomi M, Stacey DW", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "16942622", "url": "https://glygen.org/publication/PubMed/16942622" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Involvement of GSK-3beta and DYRK1B in differentiation-inducing factor-3-induced phosphorylation of cyclin D1 in HeLa cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Takahashi-Yanaga F, Mori J, Matsuzaki E, Watanabe Y, Hirata M, Miwa Y, Morimoto S, Sasaguri T", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "17046823", "url": "https://glygen.org/publication/PubMed/17046823" } ] }, { "title": "Phosphorylation-dependent ubiquitination of cyclin D1 by the SCF(FBX4-alphaB crystallin) complex.", "journal": "Molecular cell", "date": "2006", "authors": "Lin DI, Barbash O, Kumar KG, Weber JD, Harper JW, Klein-Szanto AJ, Rustgi A, Fuchs SY, Diehl JA", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "17081987", "url": "https://glygen.org/publication/PubMed/17081987" } ] }, { "title": "Regulation of CDK4.", "journal": "Cell division", "date": "2006", "authors": "Bockstaele L, Coulonval K, Kooken H, Paternot S, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "17092340", "url": "https://glygen.org/publication/PubMed/17092340" } ] }, { "title": "In vitro and in vivo activity of R547: a potent and selective cyclin-dependent kinase inhibitor currently in phase I clinical trials.", "journal": "Molecular cancer therapeutics", "date": "2006", "authors": "DePinto W, Chu XJ, Yin X, Smith M, Packman K, Goelzer P, Lovey A, Chen Y, Qian H, Hamid R, Xiang Q, Tovar C, Blain R, Nevins T, Higgins B, Luistro L, Kolinsky K, Felix B, Hussain S, Heimbrook D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "17121911", "url": "https://glygen.org/publication/PubMed/17121911" } ] }, { "title": "Dominance of SOX9 function over RUNX2 during skeletogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Zhou G, Zheng Q, Engin F, Munivez E, Chen Y, Sebald E, Krakow D, Lee B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "17142326", "url": "https://glygen.org/publication/PubMed/17142326" } ] }, { "title": "Mitotic control of RUNX2 phosphorylation by both CDK1/cyclin B kinase and PP1/PP2A phosphatase in osteoblastic cells.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Rajgopal A, Young DW, Mujeeb KA, Stein JL, Lian JB, van Wijnen AJ, Stein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "17171635", "url": "https://glygen.org/publication/PubMed/17171635" } ] }, { "title": "A critical role for FBXW8 and MAPK in cyclin D1 degradation and cancer cell proliferation.", "journal": "PloS one", "date": "2006", "authors": "Okabe H, Lee SH, Phuchareon J, Albertson DG, McCormick F, Tetsu O", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "17205132", "url": "https://glygen.org/publication/PubMed/17205132" } ] }, { "title": "Histone arginine methylation regulates pluripotency in the early mouse embryo.", "journal": "Nature", "date": "2007", "authors": "Torres-Padilla ME, Parfitt DE, Kouzarides T, Zernicka-Goetz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17215844", "url": "https://glygen.org/publication/PubMed/17215844" } ] }, { "title": "The imprinted H19 noncoding RNA is a primary microRNA precursor.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Cai X, Cullen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "17237358", "url": "https://glygen.org/publication/PubMed/17237358" } ] }, { "title": "Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.", "journal": "Cell", "date": "2007", "authors": "Grimmler M, Wang Y, Mund T, Cilensek Z, Keidel EM, Waddell MB, Jakel H, Kullmann M, Kriwacki RW, Hengst L", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "17254966", "url": "https://glygen.org/publication/PubMed/17254966" } ] }, { "title": "p27 phosphorylation by Src regulates inhibition of cyclin E-Cdk2.", "journal": "Cell", "date": "2007", "authors": "Chu I, Sun J, Arnaout A, Kahn H, Hanna W, Narod S, Sun P, Tan CK, Hengst L, Slingerland J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "17254967", "url": "https://glygen.org/publication/PubMed/17254967" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "G protein-coupled receptor 30 (GPR30) mediates gene expression changes and growth response to 17beta-estradiol and selective GPR30 ligand G-1 in ovarian cancer cells.", "journal": "Cancer research", "date": "2007", "authors": "Albanito L, Madeo A, Lappano R, Vivacqua A, Rago V, Carpino A, Oprea TI, Prossnitz ER, Musti AM, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "17308128", "url": "https://glygen.org/publication/PubMed/17308128" } ] }, { "title": "Notch1 is a p53 target gene involved in human keratinocyte tumor suppression through negative regulation of ROCK1/2 and MRCKalpha kinases.", "journal": "Genes & development", "date": "2007", "authors": "Lefort K, Mandinova A, Ostano P, Kolev V, Calpini V, Kolfschoten I, Devgan V, Lieb J, Raffoul W, Hohl D, Neel V, Garlick J, Chiorino G, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17344417", "url": "https://glygen.org/publication/PubMed/17344417" } ] }, { "title": "Characterisation of cyclin D1 down-regulation in coronavirus infected cells.", "journal": "FEBS letters", "date": "2007-04-03", "authors": "Harrison Sally M, Dove Brian K, Rothwell Lisa, Kaiser Pete, Tarpey Ian, Brooks Gavin, Hiscox Julian A", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "17359980", "url": "https://glygen.org/publication/PubMed/17359980" } ] }, { "title": "In vitro antitumor properties of a novel cyclin-dependent kinase inhibitor, P276-00.", "journal": "Molecular cancer therapeutics", "date": "2007", "authors": "Joshi KS, Rathos MJ, Joshi RD, Sivakumar M, Mascarenhas M, Kamble S, Lal B, Sharma S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "17363486", "url": "https://glygen.org/publication/PubMed/17363486" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "Cdk6 blocks myeloid differentiation by interfering with Runx1 DNA binding and Runx1-C/EBPalpha interaction.", "journal": "The EMBO journal", "date": "2007", "authors": "Fujimoto T, Anderson K, Jacobsen SE, Nishikawa SI, Nerlov C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "17431401", "url": "https://glygen.org/publication/PubMed/17431401" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "Transcriptional activation of miR-34a contributes to p53-mediated apoptosis.", "journal": "Molecular cell", "date": "2007", "authors": "Raver-Shapira N, Marciano E, Meiri E, Spector Y, Rosenfeld N, Moskovits N, Bentwich Z, Oren M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17540598", "url": "https://glygen.org/publication/PubMed/17540598" } ] }, { "title": "Transactivation of miR-34a by p53 broadly influences gene expression and promotes apoptosis.", "journal": "Molecular cell", "date": "2007", "authors": "Chang TC, Wentzel EA, Kent OA, Ramachandran K, Mullendore M, Lee KH, Feldmann G, Yamakuchi M, Ferlito M, Lowenstein CJ, Arking DE, Beer MA, Maitra A, Mendell JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17540599", "url": "https://glygen.org/publication/PubMed/17540599" } ] }, { "title": "A microRNA component of the p53 tumour suppressor network.", "journal": "Nature", "date": "2007", "authors": "He L, He X, Lim LP, de Stanchina E, Xuan Z, Liang Y, Xue W, Zender L, Magnus J, Ridzon D, Jackson AL, Linsley PS, Chen C, Lowe SW, Cleary MA, Hannon GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17554337", "url": "https://glygen.org/publication/PubMed/17554337" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "MicroRNAs 17-5p-20a-106a control monocytopoiesis through AML1 targeting and M-CSF receptor upregulation.", "journal": "Nature cell biology", "date": "2007", "authors": "Fontana L, Pelosi E, Greco P, Racanicchi S, Testa U, Liuzzi F, Croce CM, Brunetti E, Grignani F, Peschle C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "17589498", "url": "https://glygen.org/publication/PubMed/17589498" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "Monitoring Notch1 activity in development: evidence for a feedback regulatory loop.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2007", "authors": "Del Monte G, Grego-Bessa J, Gonzalez-Rajal A, Bolos V, De La Pompa JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17685488", "url": "https://glygen.org/publication/PubMed/17685488" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "MicroRNA-34b and MicroRNA-34c are targets of p53 and cooperate in control of cell proliferation and adhesion-independent growth.", "journal": "Cancer research", "date": "2007", "authors": "Corney DC, Flesken-Nikitin A, Godwin AK, Wang W, Nikitin AY", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17823410", "url": "https://glygen.org/publication/PubMed/17823410" } ] }, { "title": "Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.", "journal": "Nature", "date": "2007", "authors": "Guccione E, Bassi C, Casadio F, Martinato F, Cesaroni M, Schuchlautz H, Luscher B, Amati B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17898714", "url": "https://glygen.org/publication/PubMed/17898714" } ] }, { "title": "Differential modification of p27Kip1 controls its cyclin D-cdk4 inhibitory activity.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "James MK, Ray A, Leznova D, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "17908796", "url": "https://glygen.org/publication/PubMed/17908796" } ] }, { "title": "PKR and PKR-like endoplasmic reticulum kinase induce the proteasome-dependent degradation of cyclin D1 via a mechanism requiring eukaryotic initiation factor 2alpha phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Raven JF, Baltzis D, Wang S, Mounir Z, Papadakis AI, Gao HQ, Koromilas AE", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "18063576", "url": "https://glygen.org/publication/PubMed/18063576" } ] }, { "title": "PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.", "journal": "Genes & development", "date": "2007", "authors": "Hyllus D, Stein C, Schnabel K, Schiltz E, Imhof A, Dou Y, Hsieh J, Bauer UM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18079182", "url": "https://glygen.org/publication/PubMed/18079182" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "Runx2-mediated activation of the Bax gene increases osteosarcoma cell sensitivity to apoptosis.", "journal": "Oncogene", "date": "2008", "authors": "Eliseev RA, Dong YF, Sampson E, Zuscik MJ, Schwarz EM, O'Keefe RJ, Rosier RN, Drissi MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "18223689", "url": "https://glygen.org/publication/PubMed/18223689" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "A novel cyclin encoded by a bcl1-linked candidate oncogene.", "journal": "Nature", "date": "1991", "authors": "Motokura T, Bloom T, Kim HG, Juppner H, Ruderman JV, Kronenberg HM, Arnold A", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "1826542", "url": "https://glygen.org/publication/PubMed/1826542" } ] }, { "title": "Nonfunctional mutants of the retinoblastoma protein are characterized by defects in phosphorylation, viral oncoprotein association, and nuclear tethering.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Templeton DJ, Park SH, Lanier L, Weinberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069" } ], "reference": [ { "type": "PubMed", "id": "1826560", "url": "https://glygen.org/publication/PubMed/1826560" } ] }, { "title": "Human D-type cyclin.", "journal": "Cell", "date": "1991", "authors": "Beach D., Xiong Y., Connolly T., Futcher B.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "1827756", "url": "https://glygen.org/publication/PubMed/1827756" } ] }, { "title": "The E2F transcription factor is a cellular target for the RB protein.", "journal": "Cell", "date": "1991", "authors": "Chellappan SP, Hiebert S, Mudryj M, Horowitz JM, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "1828392", "url": "https://glygen.org/publication/PubMed/1828392" } ] }, { "title": "The retinoblastoma protein copurifies with E2F-I, an E1A-regulated inhibitor of the transcription factor E2F.", "journal": "Cell", "date": "1991", "authors": "Bagchi S, Weinmann R, Raychaudhuri P", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "1828393", "url": "https://glygen.org/publication/PubMed/1828393" } ] }, { "title": "The T/E1A-binding domain of the retinoblastoma product can interact selectively with a sequence-specific DNA-binding protein.", "journal": "Cell", "date": "1991", "authors": "Chittenden T, Livingston DM, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "1828394", "url": "https://glygen.org/publication/PubMed/1828394" } ] }, { "title": "TAN-1, the human homolog of the Drosophila notch gene, is broken by chromosomal translocations in T lymphoblastic neoplasms.", "journal": "Cell", "date": "1991", "authors": "Ellisen LW, Bird J, West DC, Soreng AL, Reynolds TC, Smith SD, Sklar J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "1831692", "url": "https://glygen.org/publication/PubMed/1831692" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "GSK-3beta-dependent destabilization of cyclin D1 mediates replicational stress-induced arrest of cell cycle.", "journal": "FEBS letters", "date": "2008", "authors": "Mukherji A, Janbandhu VC, Kumar V", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "18328826", "url": "https://glygen.org/publication/PubMed/18328826" } ] }, { "title": "Isolation of three novel human cyclins by rescue of G1 cyclin (Cln) function in yeast.", "journal": "Cell", "date": "1991", "authors": "Lew DJ, Dulic V, Reed SI", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "1833066", "url": "https://glygen.org/publication/PubMed/1833066" } ] }, { "title": "Characterization of a candidate bcl-1 gene.", "journal": "Mol. Cell. Biol.", "date": "1991", "authors": "Carey K., Faust J.B., Harvey R.C., Meeker T.C., Melnyk O., Withers D.A.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "1833629", "url": "https://glygen.org/publication/PubMed/1833629" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "A brief introduction to FOXOlogy.", "journal": "Oncogene", "date": "2008", "authors": "Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18391968", "url": "https://glygen.org/publication/PubMed/18391968" } ] }, { "title": "The histone-binding protein COPR5 is required for nuclear functions of the protein arginine methyltransferase PRMT5.", "journal": "EMBO reports", "date": "2008", "authors": "Lacroix M, El Messaoudi S, Rodier G, Le Cam A, Sardet C, Fabbrizio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18404153", "url": "https://glygen.org/publication/PubMed/18404153" } ] }, { "title": "Switching cyclin D-Cdk4 kinase activity on and off.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "18414028", "url": "https://glygen.org/publication/PubMed/18414028" } ] }, { "title": "Identification of an INSM1-binding site in the insulin promoter: negative regulation of the insulin gene transcription.", "journal": "J. Endocrinol.", "date": "2008", "authors": "Wang HW, Muguira M, Liu WD, Zhang T, Chen C, Aucoin R, Breslin MB, Lan MS", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "18417529", "url": "https://glygen.org/publication/PubMed/18417529" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Epidermal growth factor induces G protein-coupled receptor 30 expression in estrogen receptor-negative breast cancer cells.", "journal": "Endocrinology", "date": "2008", "authors": "Albanito L, Sisci D, Aquila S, Brunelli E, Vivacqua A, Madeo A, Lappano R, Pandey DP, Picard D, Mauro L, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18467441", "url": "https://glygen.org/publication/PubMed/18467441" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "Phosphorylation of cyclin D1 regulated by ATM or ATR controls cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Hitomi M, Yang K, Stacey AW, Stacey DW", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "18606783", "url": "https://glygen.org/publication/PubMed/18606783" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "Phosphorylation of p27Kip1 regulates assembly and activation of cyclin D1-Cdk4.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Larrea MD, Liang J, Da Silva T, Hong F, Shao SH, Han K, Dumont D, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "18710949", "url": "https://glygen.org/publication/PubMed/18710949" } ] }, { "title": "Brk is coamplified with ErbB2 to promote proliferation in breast cancer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Xiang B, Chatti K, Qiu H, Lakshmi B, Krasnitz A, Hicks J, Yu M, Miller WT, Muthuswamy SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "18719096", "url": "https://glygen.org/publication/PubMed/18719096" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "GSK-3beta inhibition: at the crossroad between Akt and mTOR constitutive activation to enhance cyclin D1 protein stability in mantle cell lymphoma.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Dal Col J, Dolcetti R", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "18769147", "url": "https://glygen.org/publication/PubMed/18769147" } ] }, { "title": "RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis.", "journal": "Cancer cell", "date": "2008", "authors": "Ito K, Lim AC, Salto-Tellez M, Motoda L, Osato M, Chuang LS, Lee CW, Voon DC, Koo JK, Wang H, Fukamachi H, Ito Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430" } ], "reference": [ { "type": "PubMed", "id": "18772112", "url": "https://glygen.org/publication/PubMed/18772112" } ] }, { "title": "Estrogen-induced Bcl-2 expression after spinal cord injury is mediated through phosphoinositide-3-kinase/Akt-dependent CREB activation.", "journal": "Journal of neurotrauma", "date": "2008", "authors": "Yune TY, Park HG, Lee JY, Oh TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18785877", "url": "https://glygen.org/publication/PubMed/18785877" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "SCF(Fbx4/alphaB-crystallin) E3 ligase: when one is not enough.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Barbash O, Diehl JA", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "18818515", "url": "https://glygen.org/publication/PubMed/18818515" } ] }, { "title": "Migratory localization of cyclin D2-Cdk4 complex suggests a spatial regulation of the G1-S transition.", "journal": "Cell structure and function", "date": "2008", "authors": "Wang Z, Xie Y, Zhang L, Zhang H, An X, Wang T, Meng A", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "18827403", "url": "https://glygen.org/publication/PubMed/18827403" } ] }, { "title": "Notch activates cell cycle reentry and progression in quiescent cardiomyocytes.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Campa VM, Gutierrez-Lanza R, Cerignoli F, Diaz-Trelles R, Nelson B, Tsuji T, Barcova M, Jiang W, Mercola M", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "18838555", "url": "https://glygen.org/publication/PubMed/18838555" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "ATM is required for rapid degradation of cyclin D1 in response to gamma-irradiation.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Choo DW, Baek HJ, Motoyama N, Cho KH, Kim HS, Kim SS", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "19071090", "url": "https://glygen.org/publication/PubMed/19071090" } ] }, { "title": "p27Kip1 inhibits cyclin D-cyclin-dependent kinase 4 by two independent modes.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Ray A, James MK, Larochelle S, Fisher RP, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "19075005", "url": "https://glygen.org/publication/PubMed/19075005" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "A regulatory interplay between miR-27a and Runx1 during megakaryopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ben-Ami O, Pencovich N, Lotem J, Levanon D, Groner Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "19114653", "url": "https://glygen.org/publication/PubMed/19114653" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "Zinc finger transcription factor INSM1 interrupts cyclin D1 and CDK4 binding and induces cell cycle arrest.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Zhang T, Liu WD, Saunee NA, Breslin MB, Lan MS", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "19124461", "url": "https://glygen.org/publication/PubMed/19124461" } ] }, { "title": "Hand2 controls osteoblast differentiation in the branchial arch by inhibiting DNA binding of Runx2.", "journal": "Development (Cambridge, England)", "date": "2009", "authors": "Funato N, Chapman SL, McKee MD, Funato H, Morris JA, Shelton JM, Richardson JA, Yanagisawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "19144722", "url": "https://glygen.org/publication/PubMed/19144722" } ] }, { "title": "NOTCH3 expression is induced in mural cells through an autoregulatory loop that requires endothelial-expressed JAGGED1.", "journal": "Circulation research", "date": "2009", "authors": "Liu H, Kennard S, Lilly B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19150886", "url": "https://glygen.org/publication/PubMed/19150886" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Zhao Q, Rank G, Tan YT, Li H, Moritz RL, Simpson RJ, Cerruti L, Curtis DJ, Patel DJ, Allis CD, Cunningham JM, Jane SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "19234465", "url": "https://glygen.org/publication/PubMed/19234465" } ] }, { "title": "Crystal structure of human CDK4 in complex with a D-type cyclin.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2009", "authors": "Day PJ, Cleasby A, Tickle IJ, O'Reilly M, Coyle JE, Holding FP, McMenamin RL, Yon J, Chopra R, Lengauer C, Jhoti H", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "19237565", "url": "https://glygen.org/publication/PubMed/19237565" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "HBx protein modulates PI3K/Akt pathway to overcome genotoxic stress-induced destabilization of cyclin D1 and arrest of cell cycle.", "journal": "Indian journal of biochemistry & biophysics", "date": "2009", "authors": "Mukherji A, Janbandhu VC, Kumar V", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "19374252", "url": "https://glygen.org/publication/PubMed/19374252" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "F-box protein FBXO31 mediates cyclin D1 degradation to induce G1 arrest after DNA damage.", "journal": "Nature", "date": "2009", "authors": "Santra MK, Wajapeyee N, Green MR", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "19412162", "url": "https://glygen.org/publication/PubMed/19412162" } ] }, { "title": "Combined inhibition of MEK and mammalian target of rapamycin abolishes phosphorylation of cyclin-dependent kinase 4 in glioblastoma cell lines and prevents their proliferation.", "journal": "Cancer research", "date": "2009", "authors": "Paternot S, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "19458076", "url": "https://glygen.org/publication/PubMed/19458076" } ] }, { "title": "Differential regulation of cyclin-dependent kinase 4 (CDK4) and CDK6, evidence that CDK4 might not be activated by CDK7, and design of a CDK6 activating mutation.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Bockstaele L, Bisteau X, Paternot S, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "19487459", "url": "https://glygen.org/publication/PubMed/19487459" } ] }, { "title": "Stimulating the GPR30 estrogen receptor with a novel tamoxifen analogue activates SF-1 and promotes endometrial cell proliferation.", "journal": "Cancer research", "date": "2009", "authors": "Lin BC, Suzawa M, Blind RD, Tobias SC, Bulun SE, Scanlan TS, Ingraham HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "19549922", "url": "https://glygen.org/publication/PubMed/19549922" } ] }, { "title": "MicroRNA miR-34 inhibits human pancreatic cancer tumor-initiating cells.", "journal": "PloS one", "date": "2009", "authors": "Ji Q, Hao X, Zhang M, Tang W, Yang M, Li L, Xiang D, Desano JT, Bommer GT, Fan D, Fearon ER, Lawrence TS, Xu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19714243", "url": "https://glygen.org/publication/PubMed/19714243" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "MicroRNA-206 targets notch3, activates apoptosis, and inhibits tumor cell migration and focus formation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Song G, Zhang Y, Wang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19723635", "url": "https://glygen.org/publication/PubMed/19723635" } ] }, { "title": "Lysine 269 is essential for cyclin D1 ubiquitylation by the SCF(Fbx4/alphaB-crystallin) ligase and subsequent proteasome-dependent degradation.", "journal": "Oncogene", "date": "2009", "authors": "Barbash O, Egan E, Pontano LL, Kosak J, Diehl JA", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "19767775", "url": "https://glygen.org/publication/PubMed/19767775" } ] }, { "title": "MicroRNA-34a inhibits glioblastoma growth by targeting multiple oncogenes.", "journal": "Cancer research", "date": "2009", "authors": "Li Y, Guessous F, Zhang Y, Dipierro C, Kefas B, Johnson E, Marcinkiewicz L, Jiang J, Yang Y, Schmittgen TD, Lopes B, Schiff D, Purow B, Abounader R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19773441", "url": "https://glygen.org/publication/PubMed/19773441" } ] }, { "title": "Cell proliferation regulated by estradiol receptor: Therapeutic implications.", "journal": "Steroids", "date": "2010", "authors": "Castoria G, Migliaccio A, Giovannelli P, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "19879889", "url": "https://glygen.org/publication/PubMed/19879889" } ] }, { "title": "The ATM and ATR inhibitors CGK733 and caffeine suppress cyclin D1 levels and inhibit cell proliferation.", "journal": "Radiation oncology (London, England)", "date": "2009", "authors": "Alao JP, Sunnerhagen P", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "19903334", "url": "https://glygen.org/publication/PubMed/19903334" } ] }, { "title": "Suppression of cancer cell growth by promoting cyclin D1 degradation.", "journal": "Mol. Cell", "date": "2009", "authors": "Shan J, Zhao W, Gu W", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "19917254", "url": "https://glygen.org/publication/PubMed/19917254" } ] }, { "title": "VentX, a novel lymphoid-enhancing factor/T-cell factor-associated transcription repressor, is a putative tumor suppressor.", "journal": "Cancer research", "date": "2010", "authors": "Gao H, Le Y, Wu X, Silberstein LE, Giese RW, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "20028861", "url": "https://glygen.org/publication/PubMed/20028861" } ] }, { "title": "Involvement of epigenetically silenced microRNA-181c in gastric carcinogenesis.", "journal": "Carcinogenesis", "date": "2010", "authors": "Hashimoto Y, Akiyama Y, Otsubo T, Shimada S, Yuasa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20080834", "url": "https://glygen.org/publication/PubMed/20080834" } ] }, { "title": "The G protein-coupled receptor GPR30 inhibits proliferation of estrogen receptor-positive breast cancer cells.", "journal": "Cancer research", "date": "2010", "authors": "Ariazi EA, Brailoiu E, Yerrum S, Shupp HA, Slifker MJ, Cunliffe HE, Black MA, Donato AL, Arterburn JB, Oprea TI, Prossnitz ER, Dun NJ, Jordan VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "20086172", "url": "https://glygen.org/publication/PubMed/20086172" } ] }, { "title": "Transcriptional role of cyclin D1 in development revealed by a genetic-proteomic screen.", "journal": "Nature", "date": "2010", "authors": "Bienvenu F, Jirawatnotai S, Elias JE, Meyer CA, Mizeracka K, Marson A, Frampton GM, Cole MF, Odom DT, Odajima J, Geng Y, Zagozdzon A, Jecrois M, Young RA, Liu XS, Cepko CL, Gygi SP, Sicinski P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20090754", "url": "https://glygen.org/publication/PubMed/20090754" } ] }, { "title": "Rb inactivation in cell cycle and cancer: the puzzle of highly regulated activating phosphorylation of CDK4 versus constitutively active CDK-activating kinase.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2010", "authors": "Paternot S, Bockstaele L, Bisteau X, Kooken H, Coulonval K, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "20107323", "url": "https://glygen.org/publication/PubMed/20107323" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "MicroRNA-34a suppresses invasion through downregulation of Notch1 and Jagged1 in cervical carcinoma and choriocarcinoma cells.", "journal": "Carcinogenesis", "date": "2010", "authors": "Pang RT, Leung CO, Ye TM, Liu W, Chiu PC, Lam KK, Lee KF, Yeung WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20351093", "url": "https://glygen.org/publication/PubMed/20351093" } ] }, { "title": "PCB-153 exposure coordinates cell cycle progression and cellular metabolism in human mammary epithelial cells.", "journal": "Toxicology letters", "date": "2010", "authors": "Venkatesha VA, Kalen AL, Sarsour EH, Goswami PC", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "20394812", "url": "https://glygen.org/publication/PubMed/20394812" } ] }, { "title": "TM4SF5 accelerates G1/S phase progression via cytosolic p27Kip1 expression and RhoA activity.", "journal": "Biochim. Biophys. Acta", "date": "2010", "authors": "Kim H., Lee H.J., Kim S.H., Lee J.W., Lee S.A., Kang M., Kwak T.K., Jung O.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "20399237", "url": "https://glygen.org/publication/PubMed/20399237" } ] }, { "title": "DeltaNp63alpha repression of the Notch1 gene supports the proliferative capacity of normal human keratinocytes and cervical cancer cells.", "journal": "Cancer research", "date": "2010", "authors": "Yugawa T, Narisawa-Saito M, Yoshimatsu Y, Haga K, Ohno S, Egawa N, Fujita M, Kiyono T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20442293", "url": "https://glygen.org/publication/PubMed/20442293" } ] }, { "title": "Differential control of Notch1 gene transcription by Klf4 and Sp3 transcription factors in normal versus cancer-derived keratinocytes.", "journal": "PloS one", "date": "2010", "authors": "Lambertini C, Pantano S, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20442780", "url": "https://glygen.org/publication/PubMed/20442780" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Epigenetically reprogramming metastatic tumor cells with an embryonic microenvironment.", "journal": "Epigenomics", "date": "2009", "authors": "Costa FF, Seftor EA, Bischof JM, Kirschmann DA, Strizzi L, Arndt K, Bonaldo Mde F, Soares MB, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20495621", "url": "https://glygen.org/publication/PubMed/20495621" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "Luteolin induces G1 arrest in human nasopharyngeal carcinoma cells via the Akt-GSK-3beta-Cyclin D1 pathway.", "journal": "Cancer letters", "date": "2010", "authors": "Ong CS, Zhou J, Ong CN, Shen HM", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "20655656", "url": "https://glygen.org/publication/PubMed/20655656" } ] }, { "title": "B55alpha PP2A holoenzymes modulate the phosphorylation status of the retinoblastoma-related protein p107 and its activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Jayadeva G, Kurimchak A, Garriga J, Sotillo E, Davis AJ, Haines DS, Mumby M, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "20663872", "url": "https://glygen.org/publication/PubMed/20663872" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "NOTCH1 and NOTCH3 coordinate esophageal squamous differentiation through a CSL-dependent transcriptional network.", "journal": "Gastroenterology", "date": "2010", "authors": "Ohashi S, Natsuizaka M, Yashiro-Ohtani Y, Kalman RA, Nakagawa M, Wu L, Klein-Szanto AJ, Herlyn M, Diehl JA, Katz JP, Pear WS, Seykora JT, Nakagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20801121", "url": "https://glygen.org/publication/PubMed/20801121" } ] }, { "title": "Epithelial to mesenchymal transition is mechanistically linked with stem cell signatures in prostate cancer cells.", "journal": "PloS one", "date": "2010", "authors": "Kong D, Banerjee S, Ahmad A, Li Y, Wang Z, Sethi S, Sarkar FH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20805998", "url": "https://glygen.org/publication/PubMed/20805998" } ] }, { "title": "Structural and functional analysis of cyclin D1 reveals p27 and substrate inhibitor binding requirements.", "journal": "ACS chemical biology", "date": "2010", "authors": "Liu S, Bolger JK, Kirkland LO, Premnath PN, McInnes C", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "20843055", "url": "https://glygen.org/publication/PubMed/20843055" } ] }, { "title": "Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.", "journal": "Cancer cell", "date": "2010", "authors": "Aggarwal P, Vaites LP, Kim JK, Mellert H, Gurung B, Nakagawa H, Herlyn M, Hua X, Rustgi AK, McMahon SB, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "20951943", "url": "https://glygen.org/publication/PubMed/20951943" } ] }, { "title": "p57Kip2 is a downstream effector of BCR-ABL kinase inhibitors in chronic myelogenous leukemia cells.", "journal": "Carcinogenesis", "date": "2011", "authors": "Borriello A, Caldarelli I, Bencivenga D, Cucciolla V, Oliva A, Usala E, Danise P, Ronzoni L, Perrotta S, Della Ragione F", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "20952511", "url": "https://glygen.org/publication/PubMed/20952511" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "A novel antioestrogen agent (3R,6R)-bassiatin inhibits cell proliferation and cell cycle progression by repressing cyclin D1 expression in 17beta-oestradiol-treated MCF-7 cells.", "journal": "Cell biology international", "date": "2011", "authors": "Meng L, Feng B, Tao H, Yang T, Meng Y, Zhu W, Huang C", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "21241249", "url": "https://glygen.org/publication/PubMed/21241249" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Kruppel-like family of transcription factor 9, a differentiation-associated transcription factor, suppresses Notch1 signaling and inhibits glioblastoma-initiating stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2011", "authors": "Ying M, Sang Y, Li Y, Guerrero-Cazares H, Quinones-Hinojosa A, Vescovi AL, Eberhart CG, Xia S, Laterra J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21280156", "url": "https://glygen.org/publication/PubMed/21280156" } ] }, { "title": "JAK2V617F-mediated phosphorylation of PRMT5 downregulates its methyltransferase activity and promotes myeloproliferation.", "journal": "Cancer cell", "date": "2011", "authors": "Liu F, Zhao X, Perna F, Wang L, Koppikar P, Abdel-Wahab O, Harr MW, Levine RL, Xu H, Tefferi A, Deblasio A, Hatlen M, Menendez S, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21316606", "url": "https://glygen.org/publication/PubMed/21316606" } ] }, { "title": "VentX trans-activates p53 and p16ink4a to regulate cellular senescence.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu X, Gao H, Ke W, Hager M, Xiao S, Freeman MR, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "21325273", "url": "https://glygen.org/publication/PubMed/21325273" } ] }, { "title": "Epstein-Barr virus nuclear antigen 3C facilitates G1-S transition by stabilizing and enhancing the function of cyclin D1.", "journal": "PLoS pathogens", "date": "2011", "authors": "Saha A, Halder S, Upadhyay SK, Lu J, Kumar P, Murakami M, Cai Q, Robertson ES", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "21347341", "url": "https://glygen.org/publication/PubMed/21347341" } ] }, { "title": "Endothelial Jarid2/Jumonji is required for normal cardiac development and proper Notch1 expression.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mysliwiec MR, Bresnick EH, Lee Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21402699", "url": "https://glygen.org/publication/PubMed/21402699" } ] }, { "title": "Tight function zonula occludens-3 regulates cyclin D1-dependent cell proliferation.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Capaldo CT, Koch S, Kwon M, Laur O, Parkos CA, Nusrat A", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "21411630", "url": "https://glygen.org/publication/PubMed/21411630" } ] }, { "title": "Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control.", "journal": "Oncogene", "date": "2011", "authors": "Jakel H, Weinl C, Hengst L", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "21423214", "url": "https://glygen.org/publication/PubMed/21423214" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "Modulation of microRNA expression in human T-cell development: targeting of NOTCH3 by miR-150.", "journal": "Blood", "date": "2011", "authors": "Ghisi M, Corradin A, Basso K, Frasson C, Serafin V, Mukherjee S, Mussolin L, Ruggero K, Bonanno L, Guffanti A, De Bellis G, Gerosa G, Stellin G, D'Agostino DM, Basso G, Bronte V, Indraccolo S, Amadori A, Zanovello P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21551231", "url": "https://glygen.org/publication/PubMed/21551231" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "Control of vertebrate multiciliogenesis by miR-449 through direct repression of the Delta/Notch pathway.", "journal": "Nature cell biology", "date": "2011", "authors": "Marcet B, Chevalier B, Luxardi G, Coraux C, Zaragosi LE, Cibois M, Robbe-Sermesant K, Jolly T, Cardinaud B, Moreilhon C, Giovannini-Chami L, Nawrocki-Raby B, Birembaut P, Waldmann R, Kodjabachian L, Barbry P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21602795", "url": "https://glygen.org/publication/PubMed/21602795" } ] }, { "title": "The homeobox transcription factor VentX controls human macrophage terminal differentiation and proinflammatory activation.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Wu X, Gao H, Ke W, Giese RW, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "21670496", "url": "https://glygen.org/publication/PubMed/21670496" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "Incomplete folding upon binding mediates Cdk4/cyclin D complex activation by tyrosine phosphorylation of inhibitor p27 protein.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ou L, Ferreira AM, Otieno S, Xiao L, Bashford D, Kriwacki RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "21715330", "url": "https://glygen.org/publication/PubMed/21715330" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Methylation of H2AR29 is a novel repressive PRMT6 target.", "journal": "Epigenetics & chromatin", "date": "2011", "authors": "Waldmann T, Izzo A, Kamieniarz K, Richter F, Vogler C, Sarg B, Lindner H, Young NL, Mittler G, Garcia BA, Schneider R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21774791", "url": "https://glygen.org/publication/PubMed/21774791" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "Notch signaling inhibits hepatocellular carcinoma following inactivation of the RB pathway.", "journal": "The Journal of experimental medicine", "date": "2011", "authors": "Viatour P, Ehmer U, Saddic LA, Dorrell C, Andersen JB, Lin C, Zmoos AF, Mazur PK, Schaffer BE, Ostermeier A, Vogel H, Sylvester KG, Thorgeirsson SS, Grompe M, Sage J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21875955", "url": "https://glygen.org/publication/PubMed/21875955" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "Glucose-activated RUNX2 phosphorylation promotes endothelial cell proliferation and an angiogenic phenotype.", "journal": "Journal of cellular biochemistry", "date": "2012", "authors": "Pierce AD, Anglin IE, Vitolo MI, Mochin MT, Underwood KF, Goldblum SE, Kommineni S, Passaniti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "21913213", "url": "https://glygen.org/publication/PubMed/21913213" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "NIRF constitutes a nodal point in the cell cycle network and is a candidate tumor suppressor.", "journal": "Cell Cycle", "date": "2011", "authors": "Mori T, Ikeda DD, Fukushima T, Takenoshita S, Kochi H", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "21952639", "url": "https://glygen.org/publication/PubMed/21952639" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "Wip1 promotes RUNX2-dependent apoptosis in p53-negative tumors and protects normal tissues during treatment with anticancer agents.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Goloudina AR, Tanoue K, Hammann A, Fourmaux E, Le Guezennec X, Bulavin DV, Mazur SJ, Appella E, Garrido C, Demidov ON", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "22065775", "url": "https://glygen.org/publication/PubMed/22065775" } ] }, { "title": "The Discodermia calyx toxin calyculin a enhances cyclin D1 phosphorylation and degradation, and arrests cell cycle progression in human breast cancer cells.", "journal": "Toxins", "date": "2011", "authors": "Edelson JR, Brautigan DL", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "22069692", "url": "https://glygen.org/publication/PubMed/22069692" } ] }, { "title": "Jarid2 (Jumonji, AT rich interactive domain 2) regulates NOTCH1 expression via histone modification in the developing heart.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Mysliwiec MR, Carlson CD, Tietjen J, Hung H, Ansari AZ, Lee Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "22110129", "url": "https://glygen.org/publication/PubMed/22110129" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "Symmetric dimethylation of H3R2 is a newly identified histone mark that supports euchromatin maintenance.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Migliori V, Muller J, Phalke S, Low D, Bezzi M, Mok WC, Sahu SK, Gunaratne J, Capasso P, Bassi C, Cecatiello V, De Marco A, Blackstock W, Kuznetsov V, Amati B, Mapelli M, Guccione E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "22231400", "url": "https://glygen.org/publication/PubMed/22231400" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "Control of stability of cyclin D1 by quinone reductase 2 in CWR22Rv1 prostate cancer cells.", "journal": "Carcinogenesis", "date": "2012", "authors": "Hsieh TC, Yang CJ, Lin CY, Lee YS, Wu JM", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "22266466", "url": "https://glygen.org/publication/PubMed/22266466" } ] }, { "title": "Tyrosine phosphorylation of estradiol receptor by Src regulates its hormone-dependent nuclear export and cell cycle progression in breast cancer cells.", "journal": "Oncogene", "date": "2012", "authors": "Castoria G, Giovannelli P, Lombardi M, De Rosa C, Giraldi T, de Falco A, Barone MV, Abbondanza C, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "22266855", "url": "https://glygen.org/publication/PubMed/22266855" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "Wip1 sensitizes p53-negative tumors to apoptosis by regulating the Bax/Bcl-xL ratio.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Goloudina AR, Mazur SJ, Appella E, Garrido C, Demidov ON", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "22544321", "url": "https://glygen.org/publication/PubMed/22544321" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "Cold-inducible RNA-binding protein (Cirp) interacts with Dyrk1b/Mirk and promotes proliferation of immature male germ cells in mice.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Masuda T, Itoh K, Higashitsuji H, Higashitsuji H, Nakazawa N, Sakurai T, Liu Y, Tokuchi H, Fujita T, Zhao Y, Nishiyama H, Tanaka T, Fukumoto M, Ikawa M, Okabe M, Fujita J", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "22711815", "url": "https://glygen.org/publication/PubMed/22711815" } ] }, { "title": "A Src family kinase-Shp2 axis controls RUNX1 activity in megakaryocyte and T-lymphocyte differentiation.", "journal": "Genes & development", "date": "2012", "authors": "Huang H, Woo AJ, Waldon Z, Schindler Y, Moran TB, Zhu HH, Feng GS, Steen H, Cantor AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "22759635", "url": "https://glygen.org/publication/PubMed/22759635" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "Tyrosine phosphorylation of the p21 cyclin-dependent kinase inhibitor facilitates the development of proneural glioma.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Hukkelhoven E, Liu Y, Yeh N, Ciznadija D, Blain SW, Koff A", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "23007395", "url": "https://glygen.org/publication/PubMed/23007395" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "Calyculin A from Discodermia calyx is a dual action toxin that blocks calcium influx and inhibits protein Ser/Thr phosphatases.", "journal": "Toxins", "date": "2012", "authors": "Holy M, Brautigan DL", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "23162706", "url": "https://glygen.org/publication/PubMed/23162706" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "Activation of the AKT/cyclin D1/Cdk4 survival signaling pathway in radioresistant cancer stem cells.", "journal": "Oncogenesis", "date": "2012", "authors": "Shimura T, Noma N, Oikawa T, Ochiai Y, Kakuda S, Kuwahara Y, Takai Y, Takahashi A, Fukumoto M", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "23552696", "url": "https://glygen.org/publication/PubMed/23552696" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "A Cdk7-Cdk4 T-loop phosphorylation cascade promotes G1 progression.", "journal": "Molecular cell", "date": "2013", "authors": "Schachter MM, Merrick KA, Larochelle S, Hirschi A, Zhang C, Shokat KM, Rubin SM, Fisher RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "23622515", "url": "https://glygen.org/publication/PubMed/23622515" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "Cyclin D1 harboring the T286I mutation promotes oncogenic activation in endometrial cancer.", "journal": "Oncology reports", "date": "2013", "authors": "Ikeda Y, Oda K, Hiraike-Wada O, Koso T, Miyasaka A, Kashiyama T, Tanikawa M, Sone K, Nagasaka K, Maeda D, Kawana K, Nakagawa S, Fukayama M, Tetsu O, Fujii T, Yano T, Kozuma S", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "23733133", "url": "https://glygen.org/publication/PubMed/23733133" } ] }, { "title": "CDK4 T172 phosphorylation is central in a CDK7-dependent bidirectional CDK4/CDK2 interplay mediated by p21 phosphorylation at the restriction point.", "journal": "PLoS genetics", "date": "2013", "authors": "Bisteau X, Paternot S, Colleoni B, Ecker K, Coulonval K, De Groote P, Declercq W, Hengst L, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "23737759", "url": "https://glygen.org/publication/PubMed/23737759" } ] }, { "title": "Small-molecule multi-targeted kinase inhibitor RGB-286638 triggers P53-dependent and -independent anti-multiple myeloma activity through inhibition of transcriptional CDKs.", "journal": "Leukemia", "date": "2013", "authors": "Cirstea D, Hideshima T, Santo L, Eda H, Mishima Y, Nemani N, Hu Y, Mimura N, Cottini F, Gorgun G, Ohguchi H, Suzuki R, Loferer H, Munshi NC, Anderson KC, Raje N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "23807770", "url": "https://glygen.org/publication/PubMed/23807770" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "Arsenic trioxide suppressed mantle cell lymphoma by downregulation of cyclin D1.", "journal": "Annals of hematology", "date": "2014", "authors": "Lo RK, Kwong YL", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "23949314", "url": "https://glygen.org/publication/PubMed/23949314" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "Estradiol and tamoxifen induce cell migration through GPR30 and activation of focal adhesion kinase (FAK) in endometrial cancers with low or without nuclear estrogen receptor alpha (ERalpha).", "journal": "PloS one", "date": "2013", "authors": "Tsai CL, Wu HM, Lin CY, Lin YJ, Chao A, Wang TH, Hsueh S, Lai CH, Wang HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "24039841", "url": "https://glygen.org/publication/PubMed/24039841" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "Dosage of Dyrk1a shifts cells within a p21-cyclin D1 signaling map to control the decision to enter the cell cycle.", "journal": "Molecular cell", "date": "2013", "authors": "Chen JY, Lin JR, Tsai FC, Meyer T", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "24119401", "url": "https://glygen.org/publication/PubMed/24119401" } ] }, { "title": "A novel DYRK1B inhibitor AZ191 demonstrates that DYRK1B acts independently of GSK3beta to phosphorylate cyclin D1 at Thr(286), not Thr(288).", "journal": "The Biochemical journal", "date": "2014", "authors": "Ashford AL, Oxley D, Kettle J, Hudson K, Guichard S, Cook SJ, Lochhead PA", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "24134204", "url": "https://glygen.org/publication/PubMed/24134204" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma.", "journal": "Cancer cell", "date": "2013", "authors": "Lee YS, Lee JW, Jang JW, Chi XZ, Kim JH, Li YH, Kim MK, Kim DM, Choi BS, Kim EG, Chung JH, Lee OJ, Lee YM, Suh JW, Chuang LS, Ito Y, Bae SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951936", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951936" } ], "reference": [ { "type": "PubMed", "id": "24229708", "url": "https://glygen.org/publication/PubMed/24229708" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Differential cellular and molecular effects of butyrate and trichostatin a on vascular smooth muscle cells.", "journal": "Pharmaceuticals (Basel, Switzerland)", "date": "2012", "authors": "Milton SG, Mathew OP, Yatsu FM, Ranganna K", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "24280698", "url": "https://glygen.org/publication/PubMed/24280698" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "The long non-coding RNA H19-derived miR-675 modulates human gastric cancer cell proliferation by targeting tumor suppressor RUNX1.", "journal": "Biochemical and biophysical research communications", "date": "2014", "authors": "Zhuang M, Gao W, Xu J, Wang P, Shu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "24388988", "url": "https://glygen.org/publication/PubMed/24388988" } ] }, { "title": "Genetic characterization of the role of the Cip/Kip family of proteins as cyclin-dependent kinase inhibitors and assembly factors.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Cerqueira A, Martin A, Symonds CE, Odajima J, Dubus P, Barbacid M, Santamaria D", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "24515438", "url": "https://glygen.org/publication/PubMed/24515438" } ] }, { "title": "Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu X, Gao H, Bleday R, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "24706756", "url": "https://glygen.org/publication/PubMed/24706756" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Cbfbeta deletion in mice recapitulates cleidocranial dysplasia and reveals multiple functions of Cbfbeta required for skeletal development.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Chen W, Ma J, Zhu G, Jules J, Wu M, McConnell M, Tian F, Paulson C, Zhou X, Wang L, Li YP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "24850862", "url": "https://glygen.org/publication/PubMed/24850862" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Cyclin D activates the Rb tumor suppressor by mono-phosphorylation.", "journal": "eLife", "date": "2014", "authors": "Narasimha AM, Kaulich M, Shapiro GS, Choi YJ, Sicinski P, Dowdy SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "24876129", "url": "https://glygen.org/publication/PubMed/24876129" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "Preclinical characterization of the CDK4/6 inhibitor LY2835219: in-vivo cell cycle-dependent/independent anti-tumor activities alone/in combination with gemcitabine.", "journal": "Investigational new drugs", "date": "2014", "authors": "Gelbert LM, Cai S, Lin X, Sanchez-Martinez C, Del Prado M, Lallena MJ, Torres R, Ajamie RT, Wishart GN, Flack RS, Neubauer BL, Young J, Chan EM, Iversen P, Cronier D, Kreklau E, de Dios A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "24919854", "url": "https://glygen.org/publication/PubMed/24919854" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "PSAT1 regulates cyclin D1 degradation and sustains proliferation of non-small cell lung cancer cells.", "journal": "International journal of cancer", "date": "2015", "authors": "Yang Y, Wu J, Cai J, He Z, Yuan J, Zhu X, Li Y, Li M, Guan H", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "25142862", "url": "https://glygen.org/publication/PubMed/25142862" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "MiR-18a increased the permeability of BTB via RUNX1 mediated down-regulation of ZO-1, occludin and claudin-5.", "journal": "Cellular signalling", "date": "2015", "authors": "Miao YS, Zhao YY, Zhao LN, Wang P, Liu YH, Ma J, Xue YX", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "25452107", "url": "https://glygen.org/publication/PubMed/25452107" } ] }, { "title": "Silymarin induces cyclin D1 proteasomal degradation via its phosphorylation of threonine-286 in human colorectal cancer cells.", "journal": "International immunopharmacology", "date": "2015", "authors": "Eo HJ, Park GH, Song HM, Lee JW, Kim MK, Lee MH, Lee JR, Koo JS, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "25479723", "url": "https://glygen.org/publication/PubMed/25479723" } ] }, { "title": "The CDK4/CDK6 inhibitor PD0332991 paradoxically stabilizes activated cyclin D3-CDK4/6 complexes.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2014", "authors": "Paternot S, Colleoni B, Bisteau X, Roger PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "25486476", "url": "https://glygen.org/publication/PubMed/25486476" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "MicroRNA-302b suppresses human epithelial ovarian cancer cell growth by targeting RUNX1.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2014", "authors": "Ge T, Yin M, Yang M, Liu T, Lou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "25562167", "url": "https://glygen.org/publication/PubMed/25562167" } ] }, { "title": "Ophiobolin O isolated from Aspergillus ustus induces G1 arrest of MCF-7 cells through interaction with AKT/GSK3beta/cyclin D1 signaling.", "journal": "Marine drugs", "date": "2015", "authors": "Lv C, Qin W, Zhu T, Wei S, Hong K, Zhu W, Chen R, Huang C", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "25603341", "url": "https://glygen.org/publication/PubMed/25603341" } ] }, { "title": "Tanshinone I induces cyclin D1 proteasomal degradation in an ERK1/2 dependent way in human colorectal cancer cells.", "journal": "Fitoterapia", "date": "2015", "authors": "Kim MK, Park GH, Eo HJ, Song HM, Lee JW, Kwon MJ, Koo JS, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "25615593", "url": "https://glygen.org/publication/PubMed/25615593" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "Brk/Protein tyrosine kinase 6 phosphorylates p27KIP1, regulating the activity of cyclin D-cyclin-dependent kinase 4.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Patel P, Asbach B, Shteyn E, Gomez C, Coltoff A, Bhuyan S, Tyner AL, Wagner R, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "25733683", "url": "https://glygen.org/publication/PubMed/25733683" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "Resibufogenin Induces G1-Phase Arrest through the Proteasomal Degradation of Cyclin D1 in Human Malignant Tumor Cells.", "journal": "PloS one", "date": "2015", "authors": "Ichikawa M, Sowa Y, Iizumi Y, Aono Y, Sakai T", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "26121043", "url": "https://glygen.org/publication/PubMed/26121043" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "Anti-Proliferative Effect of Naringenin through p38-Dependent Downregulation of Cyclin D1 in Human Colorectal Cancer Cells.", "journal": "Biomolecules & therapeutics", "date": "2015", "authors": "Song HM, Park GH, Eo HJ, Lee JW, Kim MK, Lee JR, Lee MH, Koo JS, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "26157550", "url": "https://glygen.org/publication/PubMed/26157550" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "p27(Kip1) signaling: Transcriptional and post-translational regulation.", "journal": "The international journal of biochemistry & cell biology", "date": "2015", "authors": "Hnit SS, Xie C, Yao M, Holst J, Bensoussan A, De Souza P, Li Z, Dong Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "26279144", "url": "https://glygen.org/publication/PubMed/26279144" } ] }, { "title": "Genetic polymorphisms in cell cycle regulatory genes CCND1 and CDK4 are associated with susceptibility to breast cancer.", "journal": "Journal of B.U.ON. : official journal of the Balkan Union of Oncology", "date": "2015", "authors": "Ullah Shah A, Mahjabeen I, Kayani MA", "evidence": [ { "database": "Entrez", "id": "595", "url": "https://www.ncbi.nlm.nih.gov/gene/595" } ], "reference": [ { "type": "PubMed", "id": "26416047", "url": "https://glygen.org/publication/PubMed/26416047" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "Cyclin-Dependent Kinase Inhibitor P1446A Induces Apoptosis in a JNK/p38 MAPK-Dependent Manner in Chronic Lymphocytic Leukemia B-Cells.", "journal": "PloS one", "date": "2015", "authors": "Paiva C, Godbersen JC, Soderquist RS, Rowland T, Kilmarx S, Spurgeon SE, Brown JR, Srinivasa SP, Danilov AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "26606677", "url": "https://glygen.org/publication/PubMed/26606677" } ] }, { "title": "miR-215 promotes malignant progression of gastric cancer by targeting RUNX1.", "journal": "Oncotarget", "date": "2016", "authors": "Li N, Zhang QY, Zou JL, Li ZW, Tian TT, Dong B, Liu XJ, Ge S, Zhu Y, Gao J, Shen L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "26716895", "url": "https://glygen.org/publication/PubMed/26716895" } ] }, { "title": "MicroRNA-378-mediated suppression of Runx1 alleviates the aggressive phenotype of triple-negative MDA-MB-231 human breast cancer cells.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2016", "authors": "Browne G, Dragon JA, Hong D, Messier TL, Gordon JA, Farina NH, Boyd JR, VanOudenhove JJ, Perez AW, Zaidi SK, Stein JL, Stein GS, Lian JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "26749280", "url": "https://glygen.org/publication/PubMed/26749280" } ] }, { "title": "Preclinical Characterization of G1T28: A Novel CDK4/6 Inhibitor for Reduction of Chemotherapy-Induced Myelosuppression.", "journal": "Molecular cancer therapeutics", "date": "2016", "authors": "Bisi JE, Sorrentino JA, Roberts PJ, Tavares FX, Strum JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "26826116", "url": "https://glygen.org/publication/PubMed/26826116" } ] }, { "title": "The involvement of cyclin D1 degradation through GSK3beta-mediated threonine-286 phosphorylation-dependent nuclear export in anti-cancer activity of mulberry root bark extracts.", "journal": "Phytomedicine : international journal of phytotherapy and phytopharmacology", "date": "2016", "authors": "Eo HJ, Park GH, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "26926171", "url": "https://glygen.org/publication/PubMed/26926171" } ] }, { "title": "Protein Kinase Ciota Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.", "journal": "Cancer cell", "date": "2016", "authors": "Ali SA, Justilien V, Jamieson L, Murray NR, Fields AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "26977885", "url": "https://glygen.org/publication/PubMed/26977885" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "Cyclin D type does not influence cell cycle response to DNA damage caused by ionizing radiation in multiple myeloma tumours.", "journal": "British journal of haematology", "date": "2016", "authors": "Smith D, Mann D, Yong K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "27146121", "url": "https://glygen.org/publication/PubMed/27146121" } ] }, { "title": "The coffee diterpene kahweol suppresses the cell proliferation by inducing cyclin D1 proteasomal degradation via ERK1/2, JNK and GKS3beta-dependent threonine-286 phosphorylation in human colorectal cancer cells.", "journal": "Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association", "date": "2016", "authors": "Park GH, Song HM, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "27424123", "url": "https://glygen.org/publication/PubMed/27424123" } ] }, { "title": "Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.", "journal": "Molecular cancer therapeutics", "date": "2016", "authors": "Chen P, Lee NV, Hu W, Xu M, Ferre RA, Lam H, Bergqvist S, Solowiej J, Diehl W, He YA, Yu X, Nagata A, VanArsdale T, Murray BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "27496135", "url": "https://glygen.org/publication/PubMed/27496135" } ] }, { "title": "The emerging role of estrogen in B cell malignancies.", "journal": "Leukemia & lymphoma", "date": "2017", "authors": "Ladikou EE, Kassi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "27557932", "url": "https://glygen.org/publication/PubMed/27557932" } ] }, { "title": "Anti-cancer activity of Psoralea fructus through the downregulation of cyclin D1 and CDK4 in human colorectal cancer cells.", "journal": "BMC complementary and alternative medicine", "date": "2016", "authors": "Park GH, Sung JH, Song HM, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "27670681", "url": "https://glygen.org/publication/PubMed/27670681" } ] }, { "title": "CCND1 mutations increase protein stability and promote ibrutinib resistance in mantle cell lymphoma.", "journal": "Oncotarget", "date": "2016", "authors": "Mohanty A, Sandoval N, Das M, Pillai R, Chen L, Chen RW, Amin HM, Wang M, Marcucci G, Weisenburger DD, Rosen ST, Pham LV, Ngo VN", "evidence": [ { "database": "Entrez", "id": "595", "url": "https://www.ncbi.nlm.nih.gov/gene/595" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "27713153", "url": "https://glygen.org/publication/PubMed/27713153" } ] }, { "title": "Berberine Suppresses Cyclin D1 Expression through Proteasomal Degradation in Human Hepatoma Cells.", "journal": "International journal of molecular sciences", "date": "2016", "authors": "Wang N, Wang X, Tan HY, Li S, Tsang CM, Tsao SW, Feng Y", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "27854312", "url": "https://glygen.org/publication/PubMed/27854312" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Resveratrol regulates gene transcription via activation of stimulus-responsive transcription factors.", "journal": "Pharmacological research", "date": "2017", "authors": "Thiel G, Rossler OG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "28012964", "url": "https://glygen.org/publication/PubMed/28012964" } ] }, { "title": "Obatoclax, a Pan-BCL-2 Inhibitor, Targets Cyclin D1 for Degradation to Induce Antiproliferation in Human Colorectal Carcinoma Cells.", "journal": "International journal of molecular sciences", "date": "2016", "authors": "Or CR, Chang Y, Lin WC, Lee WC, Su HL, Cheung MW, Huang CP, Ho C, Chang CC", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "28035994", "url": "https://glygen.org/publication/PubMed/28035994" } ] }, { "title": "Preclinical development of G1T38: A novel, potent and selective inhibitor of cyclin dependent kinases 4/6 for use as an oral antineoplastic in patients with CDK4/6 sensitive tumors.", "journal": "Oncotarget", "date": "2017", "authors": "Bisi JE, Sorrentino JA, Jordan JL, Darr DD, Roberts PJ, Tavares FX, Strum JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "28418845", "url": "https://glygen.org/publication/PubMed/28418845" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "CDK4/6 inhibitor-SHR6390 exerts potent antitumor activity in esophageal squamous cell carcinoma by inhibiting phosphorylated Rb and inducing G1 cell cycle arrest.", "journal": "Journal of translational medicine", "date": "2017", "authors": "Wang J, Li Q, Yuan J, Wang J, Chen Z, Liu Z, Li Z, Lai Y, Gao J, Shen L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "28578693", "url": "https://glygen.org/publication/PubMed/28578693" } ] }, { "title": "A role for G-protein coupled estrogen receptor (GPER) in estrogen-induced carcinogenesis: Dysregulated glandular homeostasis, survival and metastasis.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2018", "authors": "Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "28595943", "url": "https://glygen.org/publication/PubMed/28595943" } ] }, { "title": "The metabolic function of cyclin D3-CDK6 kinase in cancer cell survival.", "journal": "Nature", "date": "2017", "authors": "Wang H, Nicolay BN, Chick JM, Gao X, Geng Y, Ren H, Gao H, Yang G, Williams JA, Suski JM, Keibler MA, Sicinska E, Gerdemann U, Haining WN, Roberts TM, Polyak K, Gygi SP, Dyson NJ, Sicinski P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "28607489", "url": "https://glygen.org/publication/PubMed/28607489" } ] }, { "title": "Anticancer activity of calyx of Diospyros kaki Thunb. through downregulation of cyclin D1 via inducing proteasomal degradation and transcriptional inhibition in human colorectal cancer cells.", "journal": "BMC complementary and alternative medicine", "date": "2017", "authors": "Park SB, Park GH, Song HM, Son HJ, Um Y, Kim HS, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "28870200", "url": "https://glygen.org/publication/PubMed/28870200" } ] }, { "title": "Marine-Derived 2-Aminoimidazolone Alkaloids. Leucettamine B-Related Polyandrocarpamines Inhibit Mammalian and Protozoan DYRK & CLK Kinases.", "journal": "Marine drugs", "date": "2017", "authors": "Loaec N, Attanasio E, Villiers B, Durieu E, Tahtouh T, Cam M, Davis RA, Alencar A, Roue M, Bourguet-Kondracki ML, Proksch P, Limanton E, Guiheneuf S, Carreaux F, Bazureau JP, Klautau M, Meijer L", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "29039762", "url": "https://glygen.org/publication/PubMed/29039762" } ] }, { "title": "Human NOTCH4 is a key target of RUNX1 in megakaryocytic differentiation.", "journal": "Blood", "date": "2018", "authors": "Li Y, Jin C, Bai H, Gao Y, Sun S, Chen L, Qin L, Liu PP, Cheng L, Wang QF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "29101237", "url": "https://glygen.org/publication/PubMed/29101237" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "Voruciclib, a clinical stage oral CDK9 inhibitor, represses MCL-1 and sensitizes high-risk Diffuse Large B-cell Lymphoma to BCL2 inhibition.", "journal": "Scientific reports", "date": "2017", "authors": "Dey J, Deckwerth TL, Kerwin WS, Casalini JR, Merrell AJ, Grenley MO, Burns C, Ditzler SH, Dixon CP, Beirne E, Gillespie KC, Kleinman EF, Klinghoffer RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "29269870", "url": "https://glygen.org/publication/PubMed/29269870" } ] }, { "title": "Vitex rotundifolia Fruit Suppresses the Proliferation of Human Colorectal Cancer Cells through Down-regulation of Cyclin D1 and CDK4 via Proteasomal-Dependent Degradation and Transcriptional Inhibition.", "journal": "The American journal of Chinese medicine", "date": "2018", "authors": "Song HM, Park GH, Park SB, Kim HS, Son HJ, Um Y, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "29298515", "url": "https://glygen.org/publication/PubMed/29298515" } ] }, { "title": "Hepatocellular carcinoma-related cyclin D1 is selectively regulated by autophagy degradation system.", "journal": "Hepatology (Baltimore, Md.)", "date": "2018", "authors": "Wu SY, Lan SH, Wu SR, Chiu YC, Lin XZ, Su IJ, Tsai TF, Yen CJ, Lu TH, Liang FW, Li CY, Su HJ, Su CL, Liu HS", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "29328502", "url": "https://glygen.org/publication/PubMed/29328502" } ] }, { "title": "Anti-cancer activity of Bacillus amyloliquefaciens AK-0 through cyclin D1 proteasomal degradation via GSK3beta-dependent phosphorylation of threonine-286.", "journal": "Die Pharmazie", "date": "2017", "authors": "Park GH, Song HM, Kim YS, Jeon Y, Koo JS, Jeong HJ, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "29442024", "url": "https://glygen.org/publication/PubMed/29442024" } ] }, { "title": "Cytotoxic activity of the twigs of Cinnamomum cassia through the suppression of cell proliferation and the induction of apoptosis in human colorectal cancer cells.", "journal": "BMC complementary and alternative medicine", "date": "2018", "authors": "Park GH, Song HM, Park SB, Son HJ, Um Y, Kim HS, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "29554905", "url": "https://glygen.org/publication/PubMed/29554905" } ] }, { "title": "Oncogenic c-terminal cyclin D1 (CCND1) mutations are enriched in endometrioid endometrial adenocarcinomas.", "journal": "PloS one", "date": "2018", "authors": "Xu J, Lin DI", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "29969496", "url": "https://glygen.org/publication/PubMed/29969496" } ] }, { "title": "Chemotherapy induced PRL3 expression promotes cancer growth via plasma membrane remodeling and specific alterations of caveolae-associated signaling.", "journal": "Cell communication and signaling : CCS", "date": "2018-08-29", "authors": "Csoboz Balint, Gombos Imre, Tatrai Eniko, Tovari Jozsef, Kiss Anna L, Horvath Ibolya, Vigh Laszlo", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "30157875", "url": "https://glygen.org/publication/PubMed/30157875" } ] }, { "title": "Control of CCND1 ubiquitylation by the catalytic SAGA subunit USP22 is essential for cell cycle progression through G1 in cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Gennaro VJ, Stanek TJ, Peck AR, Sun Y, Wang F, Qie S, Knudsen KE, Rui H, Butt T, Diehl JA, McMahon SB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "30224477", "url": "https://glygen.org/publication/PubMed/30224477" } ] }, { "title": "How Selective Are Pharmacological Inhibitors of Cell-Cycle-Regulating Cyclin-Dependent Kinases?", "journal": "Journal of medicinal chemistry", "date": "2018", "authors": "Jorda R, Hendrychova D, Voller J, Reznickova E, Gucky T, Krystof V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "30234987", "url": "https://glygen.org/publication/PubMed/30234987" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "A Code of Mono-phosphorylation Modulates the Function of RB.", "journal": "Molecular cell", "date": "2019", "authors": "Sanidas I, Morris R, Fella KA, Rumde PH, Boukhali M, Tai EC, Ting DT, Lawrence MS, Haas W, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "30711375", "url": "https://glygen.org/publication/PubMed/30711375" } ] }, { "title": "Preclinical characterization of SHR6390, a novel CDK 4/6 inhibitor, in vitro and in human tumor xenograft models.", "journal": "Cancer science", "date": "2019", "authors": "Long F, He Y, Fu H, Li Y, Bao X, Wang Q, Wang Y, Xie C, Lou L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "30724426", "url": "https://glygen.org/publication/PubMed/30724426" } ] }, { "title": "Extracts from Sageretia thea reduce cell viability through inducing cyclin D1 proteasomal degradation and HO-1 expression in human colorectal cancer cells.", "journal": "BMC complementary and alternative medicine", "date": "2019", "authors": "Kim HN, Park GH, Park SB, Kim JD, Eo HJ, Son HJ, Song JH, Jeong JB", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "30736789", "url": "https://glygen.org/publication/PubMed/30736789" } ] }, { "title": "Cyclin D1 Stability Is Partly Controlled by O-GlcNAcylation.", "journal": "Frontiers in endocrinology", "date": "2019", "authors": "Masclef L, Dehennaut V, Mortuaire M, Schulz C, Leturcq M, Lefebvre T, Vercoutter-Edouart AS", "evidence": [ { "database": "O-GlcNAc Database", "id": "P24385", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P24385" } ], "reference": [ { "type": "PubMed", "id": "30853938", "url": "https://glygen.org/publication/PubMed/30853938" } ] }, { "title": "The dual PI3K/mTOR inhibitor BEZ235 restricts the growth of lung cancer tumors regardless of EGFR status, as a potent accompanist in combined therapeutic regimens.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2019", "authors": "Wu YY, Wu HC, Wu JE, Huang KY, Yang SC, Chen SX, Tsao CJ, Hsu KF, Chen YL, Hong TM", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "31262325", "url": "https://glygen.org/publication/PubMed/31262325" } ] }, { "title": "Calcineurin regulates cyclin D1 stability through dephosphorylation at T286.", "journal": "Scientific reports", "date": "2019-09-04", "authors": "Goshima Takahiro, Habara Makoto, Maeda Keisuke, Hanaki Shunsuke, Kato Yoichi, Shimada Midori", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "31484966", "url": "https://glygen.org/publication/PubMed/31484966" } ] }, { "title": "Transient Hysteresis in CDK4/6 Activity Underlies Passage of the Restriction Point in G1.", "journal": "Molecular cell", "date": "2019", "authors": "Chung M, Liu C, Yang HW, Koberlin MS, Cappell SD, Meyer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "31543423", "url": "https://glygen.org/publication/PubMed/31543423" } ] }, { "title": "p27 allosterically activates cyclin-dependent kinase 4 and antagonizes palbociclib inhibition.", "journal": "Science (New York, N.Y.)", "date": "2019", "authors": "Guiley KZ, Stevenson JW, Lou K, Barkovich KJ, Kumarasamy V, Wijeratne TU, Bunch KL, Tripathi S, Knudsen ES, Witkiewicz AK, Shokat KM, Rubin SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "31831640", "url": "https://glygen.org/publication/PubMed/31831640" } ] }, { "title": "Wogonin inhibits cell cycle progression by activating the glycogen synthase kinase-3 beta in hepatocellular carcinoma.", "journal": "Phytomedicine : international journal of phytotherapy and phytopharmacology", "date": "2020-03", "authors": "Hong Ming, Almutairi Mohammed M, Li Siying, Li Jinke", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "31991293", "url": "https://glygen.org/publication/PubMed/31991293" } ] }, { "title": "Cx43 and AKAP95 regulate G1/S conversion by competitively binding to cyclin E1/E2 in lung cancer cells.", "journal": "Thoracic cancer", "date": "2020-06", "authors": "Chen Renzhen, Chen Yu, Yuan Yangyang, Zou Xuan, Sun Qian, Lin Hongyan, Chen Xiaoyi, Liu Mingda, Deng Zifeng, Yao Youliang, Guo Dongbei, Zhang Yongxing", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "32338437", "url": "https://glygen.org/publication/PubMed/32338437" } ] }, { "title": "Perfluorooctane sulfonate (PFOS) and perfluorooctanoic acid (PFOA) induce epigenetic alterations and promote human breast cell carcinogenesis in vitro.", "journal": "Archives of toxicology", "date": "2020-11", "authors": "Pierozan Paula, Cattani Daiane, Karlsson Oskar", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "32700164", "url": "https://glygen.org/publication/PubMed/32700164" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "SHP2 promotes proliferation of breast cancer cells through regulating Cyclin D1 stability via the PI3K/AKT/GSK3\u03b2 signaling pathway.", "journal": "Cancer biology & medicine", "date": "2020-08-15", "authors": "Yuan Yue, Fan Yanling, Gao Zicong, Sun Xuan, Zhang He, Wang Zhiyong, Cui Yanfen, Song Weijie, Wang Zhaosong, Zhang Fei, Niu Ruifang", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "32944401", "url": "https://glygen.org/publication/PubMed/32944401" } ] }, { "title": "Arsenic trioxide (ATO) induced degradation of Cyclin D1 sensitized PD-1/PD-L1 checkpoint inhibitor in oral and esophageal squamous cell carcinoma.", "journal": "Journal of Cancer", "date": "2020", "authors": "Zhu Guanxia, Li Xia, Li Jiong, Zhou Wei, Chen Zhongjian, Fan Yun, Jiang Youhua, Zhao Yue, Sun Guogui, Mao Weimin", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "33046973", "url": "https://glygen.org/publication/PubMed/33046973" } ] }, { "title": "Inhibition of CDK4/6 and autophagy synergistically induces apoptosis in t(8;21) acute myeloid leukemia cells.", "journal": "International journal of hematology", "date": "2021", "authors": "Nakatani K, Matsuo H, Harata Y, Higashitani M, Koyama A, Noura M, Nishinaka-Arai Y, Kamikubo Y, Adachi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "33068248", "url": "https://glygen.org/publication/PubMed/33068248" } ] }, { "title": "LncRNA DILA1 inhibits Cyclin D1 degradation and contributes to tamoxifen resistance in breast cancer.", "journal": "Nature communications", "date": "2020", "authors": "Shi Q, Li Y, Li S, Jin L, Lai H, Wu Y, Cai Z, Zhu M, Li Q, Li Y, Wang J, Liu Y, Wu Z, Song E, Liu Q", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "33139730", "url": "https://glygen.org/publication/PubMed/33139730" } ] }, { "title": "Deferasirox induces cyclin D1 degradation and apoptosis in mantle cell lymphoma in a reactive oxygen species- and GSK3\u03b2-dependent mechanism.", "journal": "British journal of haematology", "date": "2021-02", "authors": "Samara Aladin, Shapira Saar, Lubin Ido, Shpilberg Ofer, Avigad Smadar, Granot Galit, Raanani Pia", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "33521925", "url": "https://glygen.org/publication/PubMed/33521925" } ] }, { "title": "AMBRA1 regulates cyclin D to guard S-phase entry and genomic integrity.", "journal": "Nature", "date": "2021", "authors": "Maiani E, Milletti G, Nazio F, Holdgaard SG, Bartkova J, Rizza S, Cianfanelli V, Lorente M, Simoneschi D, Di Marco M, D'Acunzo P, Di Leo L, Rasmussen R, Montagna C, Raciti M, De Stefanis C, Gabicagogeascoa E, Rona G, Salvador N, Pupo E, Merchut-Maya JM, Daniel CJ, Carinci M, Cesarini V, O'sullivan A, Jeong YT, Bordi M, Russo F, Campello S, Gallo A, Filomeni G, Lanzetti L, Sears RC, Hamerlik P, Bartolazzi A, Hynds RE, Pearce DR, Swanton C, Pagano M, Velasco G, Papaleo E, De Zio D, Maya-Mendoza A, Locatelli F, Bartek J, Cecconi F", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "33854232", "url": "https://glygen.org/publication/PubMed/33854232" } ] }, { "title": "CRL4(AMBRA1) is a master regulator of D-type cyclins.", "journal": "Nature", "date": "2021", "authors": "Simoneschi D, Rona G, Zhou N, Jeong YT, Jiang S, Milletti G, Arbini AA, O'Sullivan A, Wang AA, Nithikasem S, Keegan S, Siu Y, Cianfanelli V, Maiani E, Nazio F, Cecconi F, Boccalatte F, Fenyo D, Jones DR, Busino L, Pagano M", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" } ] }, { "title": "The AMBRA1 E3 ligase adaptor regulates the stability of cyclin D.", "journal": "Nature", "date": "2021", "authors": "Chaikovsky AC, Li C, Jeng EE, Loebell S, Lee MC, Murray CW, Cheng R, Demeter J, Swaney DL, Chen SH, Newton BW, Johnson JR, Drainas AP, Shue YT, Seoane JA, Srinivasan P, He A, Yoshida A, Hipkins SQ, McCrea E, Poltorack CD, Krogan NJ, Diehl JA, Kong C, Jackson PK, Curtis C, Petrov DA, Bassik MC, Winslow MM, Sage J", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "33854239", "url": "https://glygen.org/publication/PubMed/33854239" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P24385", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P24385" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Discovery of PF-06873600, a CDK2/4/6 Inhibitor for the Treatment of Cancer.", "journal": "Journal of medicinal chemistry", "date": "2021", "authors": "Freeman-Cook KD, Hoffman RL, Behenna DC, Boras B, Carelli J, Diehl W, Ferre RA, He YA, Hui A, Huang B, Huser N, Jones R, Kephart SE, Lapek J, McTigue M, Miller N, Murray BW, Nagata A, Nguyen L, Niessen S, Ninkovic S, O'Doherty I, Ornelas MA, Solowiej J, Sutton SC, Tran K, Tseng E, Visswanathan R, Xu M, Zehnder L, Zhang Q, Zhang C, Dann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "34110834", "url": "https://glygen.org/publication/PubMed/34110834" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P24385", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P24385" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "CircNFATC3 promotes the proliferation of gastric cancer through binding to IGF2BP3 and restricting its ubiquitination to enhance CCND1 mRNA stability.", "journal": "Journal of translational medicine", "date": "2023-06-20", "authors": "Yang Feifei, Ma Qiang, Huang Bo, Wang Xiaolin, Pan Xiaojuan, Yu Ting, Ran Lingyu, Jiang Shan, Li Haiping, Chen Ye, Liu Yuying, Liang Ce, Ren Junwu, Zhang Yuying, Wang Shimin, Li Wei, Xiao Bin", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" } ], "reference": [ { "type": "PubMed", "id": "37340423", "url": "https://glygen.org/publication/PubMed/37340423" } ] }, { "title": "CCND1-associated ceRNA network reveal the critical pathway of TPRG1-AS1-hsa-miR-363-3p-MYO1B as a prognostic marker for head and neck squamous cell carcinoma.", "journal": "Scientific reports", "date": "2023-07-22", "authors": "Li Zehao, Qiu Xinguang, He Qi, Fu Xinghao, Ji Feihong, Tian Xiufen", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" } ], "reference": [ { "type": "PubMed", "id": "37481637", "url": "https://glygen.org/publication/PubMed/37481637" } ] }, { "title": "GLIS2 and CCND1 expression levels in breast cancer patients.", "journal": "Breast disease", "date": "2023", "authors": "Sadeghi Minoosh, Gholizadeh Majid, Safataj Neda, Tahmasebivand Mahsa, Mohajeri Gholamreza, Lotfi Hajie, Bostanabad Saber Yari, Safar Behnaz, Salehi Mansoor", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" } ], "reference": [ { "type": "PubMed", "id": "37574724", "url": "https://glygen.org/publication/PubMed/37574724" } ] }, { "title": "Cyclin D1 expression, clinicopathological characteristics, and 2-year survival rate of gastric cancer in Cipto Mangunkusumo General Hospital.", "journal": "Nigerian journal of clinical practice", "date": "2023-08", "authors": "Cahyanur R, Utari A P, Rahadiani N", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" } ], "reference": [ { "type": "PubMed", "id": "37635596", "url": "https://glygen.org/publication/PubMed/37635596" } ] }, { "title": "Epigenetic Downregulation of Hsa-miR-193b-3p Increases Cyclin D1 Expression Level and Cell Proliferation in Human Meningiomas.", "journal": "International journal of molecular sciences", "date": "2023-08-30", "authors": "Kober Paulina, Mossakowska Beata Joanna, Rusetska Natalia, Baluszek Szymon, Grecka Emilia, Konopi\u0144ski Ryszard, Matyja Ewa, Ozi\u0119b\u0142o Artur, Mandat Tomasz, Bujko Mateusz", "evidence": [ { "database": "RefSeq", "id": "NP_444284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444284" } ], "reference": [ { "type": "PubMed", "id": "37686289", "url": "https://glygen.org/publication/PubMed/37686289" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "Journey to the surface of the cell: Fos regulation and the SRE.", "journal": "The EMBO journal", "date": "1995", "authors": "Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "7588619", "url": "https://glygen.org/publication/PubMed/7588619" } ] }, { "title": "Cellular targets for activation by the E2F1 transcription factor include DNA synthesis- and G1/S-regulatory genes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "DeGregori J, Kowalik T, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "7623816", "url": "https://glygen.org/publication/PubMed/7623816" } ] }, { "title": "The PRAD1/cyclin D1 proto-oncogene: genomic organization, 5' DNA sequence, and sequence of a tumor-specific rearrangement breakpoint.", "journal": "Genes Chromosomes Cancer", "date": "1993", "authors": "Arnold A., Motokura T.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "7687458", "url": "https://glygen.org/publication/PubMed/7687458" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Regulation of the retinoblastoma protein-related p107 by G1 cyclin complexes.", "journal": "Genes & development", "date": "1995", "authors": "Beijersbergen RL, Carlee L, Kerkhoven RM, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "7797074", "url": "https://glygen.org/publication/PubMed/7797074" } ] }, { "title": "ERK phosphorylation potentiates Elk-1-mediated ternary complex formation and transactivation.", "journal": "The EMBO journal", "date": "1995", "authors": "Gille H, Kortenjann M, Thomae O, Moomaw C, Slaughter C, Cobb MH, Shaw PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "7889942", "url": "https://glygen.org/publication/PubMed/7889942" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "The role of cellular transcription factor E2F in the regulation of cdc2 mRNA expression and cell cycle control of human hematopoietic cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Furukawa Y, Terui Y, Sakoe K, Ohta M, Saito M", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "7929342", "url": "https://glygen.org/publication/PubMed/7929342" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "Cyclic AMP-induced G1 phase arrest mediated by an inhibitor (p27Kip1) of cyclin-dependent kinase 4 activation.", "journal": "Cell", "date": "1994", "authors": "Kato JY, Matsuoka M, Polyak K, Massague J, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "7954814", "url": "https://glygen.org/publication/PubMed/7954814" } ] }, { "title": "Protein kinase A phosphorylates cyclin D1 at three distinct sites within the cyclin box and at the C-terminus.", "journal": "Oncogene", "date": "1994", "authors": "Sewing A, Muller R", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "8058338", "url": "https://glygen.org/publication/PubMed/8058338" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "Functional properties of a Drosophila homolog of the E2F1 gene.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Ohtani K, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "8114698", "url": "https://glygen.org/publication/PubMed/8114698" } ] }, { "title": "Identification of G1 kinase activity for cdk6, a novel cyclin D partner.", "journal": "Mol. Cell. Biol.", "date": "1994", "authors": "Meyerson M, Harlow E", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8114739", "url": "https://glygen.org/publication/PubMed/8114739" } ] }, { "title": "Regulation of cyclin D-dependent kinase 4 (cdk4) by cdk4-activating kinase.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kato JY, Matsuoka M, Strom DK, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8139570", "url": "https://glygen.org/publication/PubMed/8139570" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Rearrangement of CCND1 (BCL1/PRAD1) 3' untranslated region in mantle-cell lymphomas and t(11q13)-associated leukemias.", "journal": "Blood", "date": "1994", "authors": "Rimokh R., Bastard C., Duret L., Rouault J.-P., Archimbaud E., Berger F., French M., Klein B., Santa Lucia B., Vuillaume M.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "8204893", "url": "https://glygen.org/publication/PubMed/8204893" } ] }, { "title": "The retinoblastoma protein binds to a family of E2F transcription factors.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Lees JA, Saito M, Vidal M, Valentine M, Look T, Harlow E, Dyson N, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8246996", "url": "https://glygen.org/publication/PubMed/8246996" } ] }, { "title": "G1/S-regulated E2F-containing protein complexes bind to the mouse thymidine kinase gene promoter.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Dou QP, Zhao S, Levin AH, Wang J, Helin K, Pardee AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "8288595", "url": "https://glygen.org/publication/PubMed/8288595" } ] }, { "title": "CDK6 (PLSTIRE) and CDK4 (PSK-J3) are a distinct subset of the cyclin-dependent kinases that associate with cyclin D1.", "journal": "Oncogene", "date": "1994", "authors": "Bates S., Parry D., Peters G., Bonetta L., Dickson C., Holder A., McAllan D.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "8302605", "url": "https://glygen.org/publication/PubMed/8302605" } ] }, { "title": "A bipartite nuclear localization signal in the retinoblastoma gene product and its importance for biological activity.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Zacksenhaus E, Bremner R, Phillips RA, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8336704", "url": "https://glygen.org/publication/PubMed/8336704" } ] }, { "title": "The SRF accessory protein Elk-1 contains a growth factor-regulated transcriptional activation domain.", "journal": "Cell", "date": "1993", "authors": "Marais R, Wynne J, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "8386592", "url": "https://glygen.org/publication/PubMed/8386592" } ] }, { "title": "Molecular cloning and characterization of PEBP2 beta, the heterodimeric partner of a novel Drosophila runt-related DNA binding protein PEBP2 alpha.", "journal": "Virology", "date": "1993", "authors": "Ogawa E, Inuzuka M, Maruyama M, Satake M, Naito-Fujimoto M, Ito Y, Shigesada K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593" } ], "reference": [ { "type": "PubMed", "id": "8386878", "url": "https://glygen.org/publication/PubMed/8386878" } ] }, { "title": "Inhibition of E2F-1 transactivation by direct binding of the retinoblastoma protein.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Helin K, Harlow E, Fattaey A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069" } ], "reference": [ { "type": "PubMed", "id": "8413249", "url": "https://glygen.org/publication/PubMed/8413249" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Regions of the retinoblastoma gene product required for its interaction with the E2F transcription factor are necessary for E2 promoter repression and pRb-mediated growth suppression.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Hiebert SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "8497257", "url": "https://glygen.org/publication/PubMed/8497257" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "Regulation of the cyclin E gene by transcription factor E2F1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Ohtani K, DeGregori J, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "8618861", "url": "https://glygen.org/publication/PubMed/8618861" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "Tyrosine kinase/p21ras/MAP-kinase pathway activation by estradiol-receptor complex in MCF-7 cells.", "journal": "The EMBO journal", "date": "1996", "authors": "Migliaccio A, Di Domenico M, Castoria G, de Falco A, Bontempo P, Nola E, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "8635462", "url": "https://glygen.org/publication/PubMed/8635462" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Flavopiridol induces G1 arrest with inhibition of cyclin-dependent kinase (CDK) 2 and CDK4 in human breast carcinoma cells.", "journal": "Cancer research", "date": "1996", "authors": "Carlson BA, Dubay MM, Sausville EA, Brizuela L, Worland PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119" } ], "reference": [ { "type": "PubMed", "id": "8674031", "url": "https://glygen.org/publication/PubMed/8674031" } ] }, { "title": "Dysregulation of cyclin D1 by translocation into an IgH gamma switch region in two multiple myeloma cell lines.", "journal": "Blood", "date": "1996", "authors": "Gerhard D.S., Bergsagel P.L., Brents L.A., Chesi M., Kuehl W.M., Smith C.M.", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "reference": [ { "type": "PubMed", "id": "8695815", "url": "https://glygen.org/publication/PubMed/8695815" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "Notch3 mutations in CADASIL, a hereditary adult-onset condition causing stroke and dementia.", "journal": "Nature", "date": "1996", "authors": "Joutel A, Corpechot C, Ducros A, Vahedi K, Chabriat H, Mouton P, Alamowitch S, Domenga V, Cecillion M, Marechal E, Maciazek J, Vayssiere C, Cruaud C, Cabanis EA, Ruchoux MM, Weissenbach J, Bach JF, Bousser MG, Tournier-Lasserve E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "8878478", "url": "https://glygen.org/publication/PubMed/8878478" } ] }, { "title": "Expression of the HsOrc1 gene, a human ORC1 homolog, is regulated by cell proliferation via the E2F transcription factor.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Ohtani K, DeGregori J, Leone G, Herendeen DR, Kelly TJ, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "8943353", "url": "https://glygen.org/publication/PubMed/8943353" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Accumulation of E2F-4.DP-1 DNA binding complexes correlates with induction of dhfr gene expression during the G1 to S phase transition.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wells JM, Illenye S, Magae J, Wu CL, Heintz NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "9020173", "url": "https://glygen.org/publication/PubMed/9020173" } ] }, { "title": "The subcellular locations of p15(Ink4b) and p27(Kip1) coordinate their inhibitory interactions with cdk4 and cdk2.", "journal": "Genes & development", "date": "1997", "authors": "Reynisdottir I, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9042862", "url": "https://glygen.org/publication/PubMed/9042862" } ] }, { "title": "New functional activities for the p21 family of CDK inhibitors.", "journal": "Genes Dev.", "date": "1997", "authors": "LaBaer J, Garrett MD, Stevenson LF, Slingerland JM, Sandhu C, Chou HS, Fattaey A, Harlow E", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9106657", "url": "https://glygen.org/publication/PubMed/9106657" } ] }, { "title": "Inhibition of cyclin D1 phosphorylation on threonine-286 prevents its rapid degradation via the ubiquitin-proteasome pathway.", "journal": "Genes & development", "date": "1997", "authors": "Diehl JA, Zindy F, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815" } ], "reference": [ { "type": "PubMed", "id": "9136925", "url": "https://glygen.org/publication/PubMed/9136925" } ] }, { "title": "The subcellular localization of E2F-4 is cell-cycle dependent.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Lindeman GJ, Gaubatz S, Livingston DM, Ginsberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9144196", "url": "https://glygen.org/publication/PubMed/9144196" } ] }, { "title": "Cbfa1, a candidate gene for cleidocranial dysplasia syndrome, is essential for osteoblast differentiation and bone development.", "journal": "Cell", "date": "1997", "authors": "Otto F, Thornell AP, Crompton T, Denzel A, Gilmour KC, Rosewell IR, Stamp GW, Beddington RS, Mundlos S, Olsen BR, Selby PB, Owen MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "9182764", "url": "https://glygen.org/publication/PubMed/9182764" } ] }, { "title": "Cyclin D1/Cdk4 regulates retinoblastoma protein-mediated cell cycle arrest by site-specific phosphorylation.", "journal": "Molecular biology of the cell", "date": "1997", "authors": "Connell-Crowley L, Harper JW, Goodrich DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9190208", "url": "https://glygen.org/publication/PubMed/9190208" } ] }, { "title": "Ras links growth factor signaling to the cell cycle machinery via regulation of cyclin D1 and the Cdk inhibitor p27KIP1.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Aktas H, Cai H, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9199319", "url": "https://glygen.org/publication/PubMed/9199319" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "Missense mutations abolishing DNA binding of the osteoblast-specific transcription factor OSF2/CBFA1 in cleidocranial dysplasia.", "journal": "Nature genetics", "date": "1997", "authors": "Lee B, Thirunavukkarasu K, Zhou L, Pastore L, Baldini A, Hecht J, Geoffroy V, Ducy P, Karsenty G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8878166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166" } ], "reference": [ { "type": "PubMed", "id": "9207800", "url": "https://glygen.org/publication/PubMed/9207800" } ] }, { "title": "Induction of p27Kip1 degradation and anchorage independence by Ras through the MAP kinase signaling pathway.", "journal": "Oncogene", "date": "1997", "authors": "Kawada M, Yamagoe S, Murakami Y, Suzuki K, Mizuno S, Uehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9264403", "url": "https://glygen.org/publication/PubMed/9264403" } ] }, { "title": "Differential interaction of the cyclin-dependent kinase (Cdk) inhibitor p27Kip1 with cyclin A-Cdk2 and cyclin D2-Cdk4.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Blain SW, Montalvo E, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9325318", "url": "https://glygen.org/publication/PubMed/9325318" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Incomplete penetrance of familial retinoblastoma linked to germ-line mutations that result in partial loss of RB function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otterson GA, Chen Wd, Coxon AB, Khleif SN, Kaye FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9661069", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069" } ], "reference": [ { "type": "PubMed", "id": "9342358", "url": "https://glygen.org/publication/PubMed/9342358" } ] }, { "title": "A dominant-negative cyclin D1 mutant prevents nuclear import of cyclin-dependent kinase 4 (CDK4) and its phosphorylation by CDK-activating kinase.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Diehl JA, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815" } ], "reference": [ { "type": "PubMed", "id": "9372967", "url": "https://glygen.org/publication/PubMed/9372967" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "Functional inactivation of the retinoblastoma protein requires sequential modification by at least two distinct cyclin-cdk complexes.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Lundberg AS, Weinberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9447971", "url": "https://glygen.org/publication/PubMed/9447971" } ] }, { "title": "Assembly of cyclin D-dependent kinase and titration of p27Kip1 regulated by mitogen-activated protein kinase kinase (MEK1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Cheng M, Sexl V, Sherr CJ, Roussel MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9448290", "url": "https://glygen.org/publication/PubMed/9448290" } ] }, { "title": "A requirement for cyclin D3-cyclin-dependent kinase (cdk)-4 assembly in the cyclic adenosine monophosphate-dependent proliferation of thyrocytes.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Depoortere F, Van Keymeulen A, Lukas J, Costagliola S, Bartkova J, Dumont JE, Bartek J, Roger PP, Dremier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231" } ], "reference": [ { "type": "PubMed", "id": "9508775", "url": "https://glygen.org/publication/PubMed/9508775" } ] }, { "title": "Cdc6 is regulated by E2F and is essential for DNA replication in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Yan Z, DeGregori J, Shohet R, Leone G, Stillman B, Nevins JR, Williams RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "9520412", "url": "https://glygen.org/publication/PubMed/9520412" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "PRMT 3, a type I protein arginine N-methyltransferase that differs from PRMT1 in its oligomerization, subcellular localization, substrate specificity, and regulation.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Tang J, Gary JD, Clarke S, Herschman HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "9642256", "url": "https://glygen.org/publication/PubMed/9642256" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "A new model of cell cycle-regulated transcription: repression of the cyclin A promoter by CDF-1 and anti-repression by E2F.", "journal": "Oncogene", "date": "1998", "authors": "Liu N, Lucibello FC, Engeland K, Muller R", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "9662327", "url": "https://glygen.org/publication/PubMed/9662327" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "Cloning, characterization, and the complete 56.8-kilobase DNA sequence of the human NOTCH4 gene.", "journal": "Genomics", "date": "1998", "authors": "Li L, Huang GM, Banta AB, Deng Y, Smith T, Dong P, Friedman C, Chen L, Trask BJ, Spies T, Rowen L, Hood L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "9693032", "url": "https://glygen.org/publication/PubMed/9693032" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "Regulation of cell growth-dependent expression of mammalian CDC6 gene by the cell cycle transcription factor E2F.", "journal": "Oncogene", "date": "1998", "authors": "Ohtani K, Tsujimoto A, Ikeda M, Nakamura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-69205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205" } ], "reference": [ { "type": "PubMed", "id": "9778043", "url": "https://glygen.org/publication/PubMed/9778043" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "Glycogen synthase kinase-3beta regulates cyclin D1 proteolysis and subcellular localization.", "journal": "Genes & development", "date": "1998", "authors": "Diehl JA, Cheng M, Roussel MF, Sherr CJ", "evidence": [ { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" } ], "reference": [ { "type": "PubMed", "id": "9832503", "url": "https://glygen.org/publication/PubMed/9832503" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] } ], "pathway": [ { "id": "hsa:595", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:595", "resource": "KEGG Pathway" }, { "id": "R-HSA-187577", "name": "SCF(Skp2)-mediated degradation of p27/p21", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577", "resource": "Reactome", "description": "SCF(Skp2)-mediated degradation of p27/p21" }, { "id": "R-HSA-1912408", "name": "Pre-NOTCH Transcription and Translation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408", "resource": "Reactome", "description": "Pre-NOTCH Transcription and Translation" }, { "id": "R-HSA-3214858", "name": "RMTs methylate histone arginines", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "resource": "Reactome", "description": "RMTs methylate histone arginines" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-69205", "name": "G1/S-Specific Transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205", "resource": "Reactome", "description": "G1/S-Specific Transcription" }, { "id": "R-HSA-69231", "name": "Cyclin D associated events in G1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69231", "resource": "Reactome", "description": "Cyclin D associated events in G1" }, { "id": "R-HSA-75815", "name": "Ubiquitin-dependent degradation of Cyclin D", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815", "resource": "Reactome", "description": "Ubiquitin-dependent degradation of Cyclin D" }, { "id": "R-HSA-8849470", "name": "PTK6 Regulates Cell Cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849470", "resource": "Reactome", "description": "PTK6 Regulates Cell Cycle" }, { "id": "R-HSA-8853884", "name": "Transcriptional Regulation by VENTX", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884", "resource": "Reactome", "description": "Transcriptional Regulation by VENTX" }, { "id": "R-HSA-8878166", "name": "Transcriptional regulation by RUNX2", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878166", "resource": "Reactome", "description": "Transcriptional regulation by RUNX2" }, { "id": "R-HSA-8934593", "name": "Regulation of RUNX1 Expression and Activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8934593", "resource": "Reactome", "description": "Regulation of RUNX1 Expression and Activity" }, { "id": "R-HSA-8951430", "name": "RUNX3 regulates WNT signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951430", "resource": "Reactome", "description": "RUNX3 regulates WNT signaling" }, { "id": "R-HSA-8951936", "name": "RUNX3 regulates p14-ARF", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951936", "resource": "Reactome", "description": "RUNX3 regulates p14-ARF" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-9634638", "name": "Estrogen-dependent nuclear events downstream of ESR-membrane signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638", "resource": "Reactome", "description": "Estrogen-dependent nuclear events downstream of ESR-membrane signaling" }, { "id": "R-HSA-9661069", "name": "Defective binding of RB1 mutants to E2F1,(E2F2, E2F3)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9661069", "resource": "Reactome", "description": "Defective binding of RB1 mutants to E2F1,(E2F2, E2F3)" }, { "id": "R-HSA-9754119", "name": "Drug-mediated inhibition of CDK4/CDK6 activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754119", "resource": "Reactome", "description": "Drug-mediated inhibition of CDK4/CDK6 activity" } ], "orthologs": [ { "uniprot_canonical_ac": "P25322-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "Ccnd1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI", "length": 295 }, "evidence": [ { "id": "45225224", "url": "http://www.informatics.jax.org/homology/45225224", "database": "MGI" }, { "id": "P24385", "url": "https://omabrowser.org/oma/group/P24385/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P39948-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "Ccnd1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQREIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNIDPKATEEEGEVEEEAGLACTPTDVRDVDI", "length": 295 }, "evidence": [ { "id": "45225224", "url": "http://www.informatics.jax.org/homology/45225224", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 26, "go_terms": [ { "name": "mitotic cell cycle phase transition", "id": "GO:0044772", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044772", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "positive regulation of G2/M transition of mitotic cell cycle", "id": "GO:0010971", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010971", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "negative regulation of neuron apoptotic process", "id": "GO:0043524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043524", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "Wnt signaling pathway", "id": "GO:0016055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016055", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "fat cell differentiation", "id": "GO:0045444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045444", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "regulation of cyclin-dependent protein serine/threonine kinase activity", "id": "GO:0000079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000079", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "G1/S transition of mitotic cell cycle", "id": "GO:0000082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000082", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "lactation", "id": "GO:0007595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007595", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "mammary gland alveolus development", "id": "GO:0060749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060749", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "endoplasmic reticulum unfolded protein response", "id": "GO:0030968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030968", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "response to UV-A", "id": "GO:0070141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070141", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "liver regeneration", "id": "GO:0097421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097421", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "re-entry into mitotic cell cycle", "id": "GO:0000320", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000320", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "negative regulation of epithelial cell differentiation", "id": "GO:0030857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030857", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "mitotic G1 DNA damage checkpoint signaling", "id": "GO:0031571", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031571", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "mammary gland epithelial cell proliferation", "id": "GO:0033598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033598", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "positive regulation of mammary gland epithelial cell proliferation", "id": "GO:0033601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033601", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "response to leptin", "id": "GO:0044321", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044321", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "positive regulation of cyclin-dependent protein serine/threonine kinase activity", "id": "GO:0045737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045737", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "protein kinase activity", "id": "GO:0004672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004672", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "histone deacetylase binding", "id": "GO:0042826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042826", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "proline-rich region binding", "id": "GO:0070064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070064", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "cyclin-dependent protein serine/threonine kinase regulator activity", "id": "GO:0016538", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016538", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "cyclin-dependent protein serine/threonine kinase activator activity", "id": "GO:0061575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061575", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "bicellular tight junction", "id": "GO:0005923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005923", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "transcription repressor complex", "id": "GO:0017053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017053", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "cyclin-dependent protein kinase holoenzyme complex", "id": "GO:0000307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000307", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" }, { "name": "cyclin D1-CDK4 complex", "id": "GO:0097128", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097128", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylation at Thr-286 by MAP kinases is required for ubiquitination and degradation by the DCX(AMBRA1) complex (PubMed:10766840, PubMed:33854232, PubMed:33854235, PubMed:33854239). It also plays an essential role for recognition by the FBXO31 component of SCF (SKP1-cullin-F-box) protein ligase complex following DNA damage (PubMed:19412162).", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "PubMed", "id": "10766840", "url": "https://glygen.org/publication/PubMed/10766840" }, { "database": "PubMed", "id": "19412162", "url": "https://glygen.org/publication/PubMed/19412162" }, { "database": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" }, { "database": "PubMed", "id": "33854239", "url": "https://glygen.org/publication/PubMed/33854239" }, { "database": "PubMed", "id": "33854232", "url": "https://glygen.org/publication/PubMed/33854232" } ] }, { "annotation": "Ubiquitinated at Lys-269 by the DCX(AMBRA1) complex during the transition from G1 to S cell phase, leading to its degradation: ubiquitination is dependent on Thr-286 phosphorylation (PubMed:33854232, PubMed:33854235, PubMed:33854239). The DCX(AMBRA1) complex represents the major regulator of CCND1 stability during the G1/S transition (PubMed:33854232, PubMed:33854235, PubMed:33854239). Also ubiquitinated by a SCF (SKP1-CUL1-F-box protein) ubiquitin-protein ligase complex containing FBXO4 and CRYAB (By similarity). Following DNA damage it is ubiquitinated by some SCF (SKP1-cullin-F-box) protein ligase complex containing FBXO31 (PubMed:19412162). SCF-type ubiquitination is dependent on Thr-286 phosphorylation (PubMed:10766840, PubMed:19412162). Ubiquitinated also by UHRF2 apparently in a phosphorylation-independent manner (PubMed:21952639). Ubiquitination leads to its degradation and G1 arrest. Deubiquitinated by USP2; leading to its stabilization (PubMed:19917254).", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprot/P24385" }, { "database": "PubMed", "id": "19917254", "url": "https://glygen.org/publication/PubMed/19917254" }, { "database": "PubMed", "id": "P25322", "url": "https://glygen.org/publication/PubMed/P25322" }, { "database": "PubMed", "id": "10766840", "url": "https://glygen.org/publication/PubMed/10766840" }, { "database": "PubMed", "id": "19412162", "url": "https://glygen.org/publication/PubMed/19412162" }, { "database": "PubMed", "id": "21952639", "url": "https://glygen.org/publication/PubMed/21952639" }, { "database": "PubMed", "id": "33854235", "url": "https://glygen.org/publication/PubMed/33854235" }, { "database": "PubMed", "id": "33854239", "url": "https://glygen.org/publication/PubMed/33854239" }, { "database": "PubMed", "id": "33854232", "url": "https://glygen.org/publication/PubMed/33854232" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 568 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }