{ "uniprot_canonical_ac": "P24090-1", "uniprot_ac": "P24090", "uniprot_id": "FETUA_RAT", "mass": { "chemical_mass": 37982.0, "monoisotopic_mass": 37982.0 }, "refseq": { "ac": "NP_037030", "name": "alpha-2-HS-glycoprotein precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030" }, "gene_names": [ { "name": "Ahsg", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P24090", "id": "P24090" }, { "name": "AABR07034632.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P24090", "id": "P24090" }, { "name": "Aa2-066; BSP; pp63", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030", "id": "NP_037030" }, { "name": "Ahsg", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030", "id": "NP_037030" }, { "name": "Fetua", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P24090", "id": "P24090" } ], "protein_names": [ { "name": "Alpha-2-HS-glycoprotein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P24090" }, { "name": "59 kDa bone sialic acid-containing protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24090" }, { "name": "BSP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24090" }, { "name": "Fetuin-A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24090" }, { "name": "Glycoprotein PP63", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P24090" }, { "name": "alpha-2-HS-glycoprotein precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030", "id": "NP_037030" }, { "name": "fetuin-A; glycoprotein PP63; 59 kDa bone sialic acid-containing protein; alpha 2 HS-glycoprotein alpha 2 (fetuin); phosphorylated N-glycoprotein pp63", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030", "id": "NP_037030" } ], "function": [ { "annotation": "Could inhibit both insulin-receptor tyrosine kinase activity and insulin-stimulated receptor autophosphorylation and, concomitantly, antagonize the mitogenic effect of the hormone in cultured rat hepatoma cells.", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090#function" } ] }, { "annotation": "Fetuin-A Deficiency but Not Pentraxin 3, FGF-21, or Irisin, Predisposes to More Serious COVID-19 Course. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_037030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030" }, { "database": "PubMed", "id": "34680053", "url": "https://glygen.org/publication/PubMed/34680053" } ] }, { "annotation": "Fetuin-A exerts the stimulatory effects on inflammatory responses in HUVECs, macrophage foam cell formation, and proliferation and collagen production in HASMCs, leading to the development of atherosclerosis. Erratum:[Atherosclerosis. 2016 Oct;253:346. PMID: 27184817]", "evidence": [ { "database": "RefSeq", "id": "NP_037030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030" }, { "database": "PubMed", "id": "26828753", "url": "https://glygen.org/publication/PubMed/26828753" } ] }, { "annotation": "The protective effects of pioglitazone on lipotoxicity in beta cells may involve the inhibition of the activation of the Fetuin A and TLR4 signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_037030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030" }, { "database": "PubMed", "id": "25986658", "url": "https://glygen.org/publication/PubMed/25986658" } ] } ], "disease": [ { "disease_id": "DOID:0080628", "recommended_name": { "id": "DOID:0080628", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080628", "name": "alopecia-mental retardation syndrome 1", "description": "An alopecia-mental retardation syndrome that has_material_basis_in homozygous mutation in the AHSG gene on chromosome 3q27." }, "synonyms": [ { "id": "MONDO:0021035", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021035", "name": "alopecia-intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0021035", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021035", "name": "APMR", "description": "" }, { "id": "MONDO:0021035", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021035", "name": "APMR1", "description": "" }, { "id": "MONDO:0021035", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021035", "name": "alopecia-intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0021035", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021035", "name": "alopecia-mental retardation syndrome 1", "description": "" }, { "id": "MIM:203650", "resource": "MIM", "url": "https://www.omim.org/entry/203650", "name": "Alopecia-intellectual disability syndrome 1", "description": "Alopecia-intellectual disability syndrome 1" } ], "evidence": [ { "id": "0080628", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080628" } ] }, { "disease_id": "DOID:11714", "recommended_name": { "id": "DOID:11714", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11714", "name": "gestational diabetes", "description": "A diabetes mellitus that manifests during pregnancy." }, "synonyms": [ { "id": "DOID:11714", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11714", "name": "GDM", "description": "" }, { "id": "DOID:11714", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11714", "name": "Gestational diabetes mellitus", "description": "" }, { "id": "DOID:11714", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11714", "name": "Maternal gestational diabetes mellitus", "description": "" } ], "evidence": [ { "id": "11714", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11714" } ] }, { "disease_id": "DOID:3393", "recommended_name": { "id": "DOID:3393", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3393", "name": "coronary artery disease", "description": "An artery disease that is characterized by plaque building up along the inner walls of the arteries of the heart resulting in a narrowing of the arteries and a reduced blood supply to the cardiac muscles." }, "synonyms": [ { "id": "DOID:3393", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3393", "name": "CHD", "description": "" }, { "id": "DOID:3393", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3393", "name": "Coronary disease", "description": "" }, { "id": "DOID:3393", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3393", "name": "coronary arteriosclerosis", "description": "" }, { "id": "DOID:3393", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3393", "name": "coronary heart disease", "description": "" }, { "id": "MONDO:0012010", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012010", "name": "coronary heart disease, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012010", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012010", "name": "coronary heart disease, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012010", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012010", "name": "coronary heart disease, susceptibility to, type 4", "description": "" }, { "id": "MONDO:0012010", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012010", "name": "Chds4", "description": "" }, { "id": "MONDO:0012009", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012009", "name": "coronary heart disease, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012009", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012009", "name": "coronary heart disease, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012009", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012009", "name": "coronary heart disease, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012009", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012009", "name": "Chds2", "description": "" }, { "id": "MONDO:0013671", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013671", "name": "hydatidiform mole, recurrent, 2", "description": "Any complete hydatidiform mole in which the cause of the disease is a mutation in the KHDC3L gene." }, { "id": "MONDO:0013671", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013671", "name": "KHDC3L complete hydatidiform mole", "description": "" }, { "id": "MONDO:0013671", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013671", "name": "complete hydatidiform mole caused by mutation in KHDC3L", "description": "" }, { "id": "MONDO:0013671", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013671", "name": "hydatidiform Mole, recurrent, type 2", "description": "" }, { "id": "MONDO:0013671", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013671", "name": "hydatidiform mole, recurrent, 2", "description": "" }, { "id": "MONDO:0013671", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013671", "name": "HYDM2", "description": "" }, { "id": "MONDO:0013671", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013671", "name": "hydatidiform MOLE, recurrent, 2", "description": "" }, { "id": "MONDO:0013671", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013671", "name": "hydatidiform Mole, complete", "description": "" }, { "id": "MONDO:0011817", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011817", "name": "coronary heart disease, susceptibility to, 1", "description": "Any coronary artery disease in which the cause of the disease is a mutation in the CX3CR1 gene." }, { "id": "MONDO:0011817", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011817", "name": "CX3CR1 coronary artery disease", "description": "" }, { "id": "MONDO:0011817", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011817", "name": "coronary artery disease caused by mutation in CX3CR1", "description": "" }, { "id": "MONDO:0011817", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011817", "name": "coronary artery disease, resistance to", "description": "" }, { "id": "MONDO:0011817", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011817", "name": "coronary heart disease, susceptibility to", "description": "" }, { "id": "MONDO:0011817", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011817", "name": "coronary heart disease, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011817", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011817", "name": "coronary heart disease, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0011817", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011817", "name": "Chds1", "description": "" }, { "id": "MONDO:0012011", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012011", "name": "coronary artery disease, autosomal dominant, 1", "description": "Any coronary artery disease in which the cause of the disease is a mutation in the MEF2A gene." }, { "id": "MONDO:0012011", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012011", "name": "MEF2A coronary artery disease", "description": "" }, { "id": "MONDO:0012011", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012011", "name": "coronary artery disease caused by mutation in MEF2A", "description": "" }, { "id": "MONDO:0012011", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012011", "name": "coronary artery disease, autosomal dominant, 1", "description": "" }, { "id": "MONDO:0012011", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012011", "name": "coronary artery disease, autosomal dominant, type 1", "description": "" }, { "id": "MONDO:0012011", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012011", "name": "ADCAD1", "description": "" }, { "id": "MONDO:0012011", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012011", "name": "coronary artery disease with myocardial infarction", "description": "" }, { "id": "MONDO:0012586", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012586", "name": "coronary artery disease, autosomal dominant 2", "description": "Any coronary artery disease in which the cause of the disease is a mutation in the LRP6 gene." }, { "id": "MONDO:0012586", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012586", "name": "LRP6 coronary artery disease", "description": "" }, { "id": "MONDO:0012586", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012586", "name": "coronary artery disease caused by mutation in LRP6", "description": "" }, { "id": "MONDO:0012586", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012586", "name": "coronary artery disease, autosomal dominant 2", "description": "" }, { "id": "MONDO:0012586", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012586", "name": "coronary artery disease, autosomal dominant type 2", "description": "" }, { "id": "MONDO:0012586", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012586", "name": "coronary artery disease, autosomal dominant, 2", "description": "" }, { "id": "MONDO:0012586", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012586", "name": "ADCAD2", "description": "" }, { "id": "MONDO:0012788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012788", "name": "coronary heart disease, susceptibility to, 9", "description": "" }, { "id": "MONDO:0012788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012788", "name": "CHDS9", "description": "" }, { "id": "MONDO:0012788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012788", "name": "coronary heart disease, susceptibility to, 9", "description": "" }, { "id": "MONDO:0010331", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010331", "name": "coronary heart disease, susceptibility to, 3", "description": "" }, { "id": "MONDO:0010331", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010331", "name": "coronary heart disease, susceptibility to, 3", "description": "" }, { "id": "MONDO:0010331", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010331", "name": "coronary heart disease, susceptibility to, type 3", "description": "" }, { "id": "MONDO:0010331", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010331", "name": "Chds3", "description": "" }, { "id": "MONDO:0012628", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012628", "name": "coronary heart disease, susceptibility to, 8", "description": "" }, { "id": "MONDO:0012628", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012628", "name": "CHDS8", "description": "" }, { "id": "MONDO:0012628", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012628", "name": "coronary heart disease, susceptibility to, 8", "description": "" }, { "id": "MIM:614293", "resource": "MIM", "url": "https://www.omim.org/entry/614293", "name": "Hydatidiform mole, recurrent, 2", "description": "Hydatidiform mole, recurrent, 2" }, { "id": "MIM:608320", "resource": "MIM", "url": "https://www.omim.org/entry/608320", "name": "Coronary artery disease, autosomal dominant, 1", "description": "Coronary artery disease, autosomal dominant, 1" }, { "id": "MIM:610947", "resource": "MIM", "url": "https://www.omim.org/entry/610947", "name": "Coronary artery disease, autosomal dominant, 2", "description": "Coronary artery disease, autosomal dominant, 2" } ], "evidence": [ { "id": "3393", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3393" } ] }, { "disease_id": "DOID:5844", "recommended_name": { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "myocardial infarction", "description": "A coronary artery disease characterized by myocardial cell death (myocardial necrosis) due to prolonged ischaemia." }, "synonyms": [ { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "Myocardial infarct", "description": "" }, { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "heart attack", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "Mci2", "description": "" } ], "evidence": [ { "id": "5844", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5844" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ahsg", "url": "https://www.uniprot.org/uniprot/P24090", "locus": { "chromosome": "11", "start_pos": 78117918, "end_pos": 78145999, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000038370", "url": "https://www.ensembl.org/id/ENSRNOG00000038370" } ] } } ], "crossref": [ { "id": "ENSRNOG00000038370", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000038370", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00042", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00042", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "25373", "url": "https://www.ncbi.nlm.nih.gov/gene/25373", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "F1LM19", "url": "https://www.ebi.ac.uk/intact/interactors/id:F1LM19*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P24090", "url": "https://www.ebi.ac.uk/intact/interactors/id:P24090*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000010", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000010", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001363", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001363", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046350", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046350", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:25373", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:25373", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "EVKVWPR", "url": "https://omabrowser.org/oma/group/EVKVWPR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5312104at2759", "url": "http://www.orthodb.org/?query=5312104at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13814", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13814", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13814:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13814:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00031", "url": "http://pfam.xfam.org/family/PF00031", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P24090", "url": "http://purl.obolibrary.org/obo/PR_P24090", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_037030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "15004297", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=15004297", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "2075", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2075", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "P24090", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A8I5Y586", "url": "https://www.uniprot.org/uniprot/A0A8I5Y586", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5Y586-1", "url": "https://www.uniprot.org/uniprot/A0A8I5Y586-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZY55", "url": "https://www.uniprot.org/uniprot/A0A8I5ZY55", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZY55-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZY55-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LM19", "url": "https://www.uniprot.org/uniprot/F1LM19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LM19-1", "url": "https://www.uniprot.org/uniprot/F1LM19-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P24090-1", "url": "https://www.uniprot.org/uniprot/P24090-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TP75", "url": "https://www.uniprot.org/uniprot/Q7TP75", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TP75-1", "url": "https://www.uniprot.org/uniprot/Q7TP75-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKSLVLLLCFAQLWSCQSAPQGAGLGFRELACDDPETEHVALIAVDYLNKHLLQGFRQILNQIDKVKVWSRRPFGEVYELEIDTLETTCHALDPTPLANCSVRQQAEHAVEGDCDFHILKQDGQFRVLHAQCHSTPDSAEDVRKFCPRCPILIRFNDTNVVHTVKTALAAFNAQNNGTYFKLVEISRAQNVPFPVSTLVEFVIAATDCTGQEVTDPAKCNLLAEKQYGFCKATLIHRLGGEEVSVACKLFQTQPQPANANPAGPAPTVGQAAPVAPPAGPPESVVVGPVAVPLGLPDHRTHHDLRHAFSPVASVESASGEVLHSPKVGQPGDAGAAGPVAPLCPGRVRYFKI", "length": 352, "header": "sp|P24090-1|FETUA_RAT Isoform 1 of Alpha-2-HS-glycoprotein OS=Rattus norvegicus OX=10116 GN=Ahsg PE=1 SV=2 CANONICAL=P24090-1" }, "isoforms": [ { "isoform_ac": "A0A8I5Y586-1", "url": "", "sequence": { "sequence": "TARQKTQSSACLCSSLQGLVRPFGEVYELEIDTLETTCHALDPTPLANCSVRQQAEHAVEGDCDFHILKQDGQFRVLHAQCHSTPDSAEDVRKFCPRCPILIRFNDTNVVHTVKTALAAFNAQNNGTYFKLVEISRAQNVPFPVSTLVEFVIAATDCTGQEVTDPAKCNLLAEKQYGFCKATLIHRLGGEEVSVACKLFQTQPQPANANPAGPAPTVGQAAPVAPPAGPPESVVVGPVAVPLGLPDHRTHHDLRHAFSPVASVESASGEVLHSPKVGQPGDAGAAGPVAPLCPGRVRYFKI", "length": 301, "header": "tr|A0A8I5Y586-1|A0A8I5Y586_RAT Computationally mapped isoform of Alpha-2-HS-glycoprotein OS=Rattus norvegicus OX=10116 GN=Ahsg PE=1 SV=1 CANONICAL=P24090-1" }, "locus": { "chromosome": "11", "start_pos": 78129321, "end_pos": 78121750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000108250.1", "url": "https://www.ensembl.org/id/ENSRNOT00000108250.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000077003.1", "url": "https://www.ensembl.org/id/ENSRNOP00000077003.1" } ] } }, { "isoform_ac": "A0A8I5ZY55-1", "url": "", "sequence": { "sequence": "MPNSQTEDTEQCLPVLFPAGPGGEVFGEEGEVFREEGEIFREEGEVFREEGEVFREEGEVCREEGEVCREEGEVCMEEGEVCMEEGEVCMEEGEVCREEGEVFREEGEVCMEEGEVFREEGEVCREEGEVCRKEGEVCREEGDVFREEGEVFREVGEVCMEEGEVFREEGEVLKEEGEIFREEGEVLKEEGEVCMEEGEVFREEGEVCMEEGEIFREEGEYLEGDQSTTLEESGLSGAAMKSLVLLLCFAQLWSCQSAPQGAGLGFRELACDDPETEHVALIAVDYLNKHLLQGFRQILNQIDKVKVWSRRPFGEVYELEIDTLETTCHALDPTPLANCSVRQQAEHAVEGDCDFHILKQDGQFRVLHAQCHSTPDSAEDVRKFCPRCPILIRFNDTNVVHTVKTALAAFNAQNNGTYFKLVEISRAQNVQYGFCKATLIHRLGGEEVSVACKLFQTQPQPANANPAGPAPTVGQAAPVAPPAGPPESVVVGPVAVPLGLPDHRTHHDLRHAFSPVASVESASGEVLHSPKVGQPGDAGAAGPVAPLCPGRVRYFKI", "length": 557, "header": "tr|A0A8I5ZY55-1|FETUA_RAT Computationally mapped isoform of Alpha-2-HS-glycoprotein OS=Rattus norvegicus OX=10116 GN=Ahsg PE=1 SV=1 CANONICAL=P24090-1" }, "locus": { "chromosome": "11", "start_pos": 78129328, "end_pos": 78121750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000103458.1", "url": "https://www.ensembl.org/id/ENSRNOT00000103458.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000082555.1", "url": "https://www.ensembl.org/id/ENSRNOP00000082555.1" } ] } }, { "isoform_ac": "F1LM19-1", "url": "", "sequence": { "sequence": "MKSLVLLLCFAQLWSCQSAPQGAGLGFRELACDDPETEHVALIAVDYLNKHLLQGFRQILNQIDKVKVWSRRPFGEVYELEIDTLETTCHALDPTPLANCSVRQQAEHAVEGDCDFHILKQDGQFRVLHAQCHSTPDSAEDVRKFCPRCPILIRFNDTNVVHTVKTALAAFNAQNNGTYFKLVEISRAQNVPIGCSVLFSLYFSARDVTEKKRKQEAKIFLLQKQQYGFCKATLIHRLGGEEVSVACKLFQTQPQPANANPAGPAPTVGQAAPVAPPAGPPESVVVGPVAVPLGLPDHRTHHDLRHAFSPVASVESASGEVLHSPKVGQPGDAGAAGPVAPLCPGRVRYFKI", "length": 352, "header": "tr|F1LM19-1|F1LM19_RAT Computationally mapped isoform of Alpha-2-HS-glycoprotein OS=Rattus norvegicus OX=10116 GN=Ahsg PE=1 SV=3 CANONICAL=P24090-1" }, "locus": { "chromosome": "11", "start_pos": 78127926, "end_pos": 78121750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000058422", "url": "https://www.ensembl.org/id/ENSRNOT00000058422" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000055223", "url": "https://www.ensembl.org/id/ENSRNOP00000055223" } ] } }, { "isoform_ac": "P24090-1", "url": "", "sequence": { "sequence": "MKSLVLLLCFAQLWSCQSAPQGAGLGFRELACDDPETEHVALIAVDYLNKHLLQGFRQILNQIDKVKVWSRRPFGEVYELEIDTLETTCHALDPTPLANCSVRQQAEHAVEGDCDFHILKQDGQFRVLHAQCHSTPDSAEDVRKFCPRCPILIRFNDTNVVHTVKTALAAFNAQNNGTYFKLVEISRAQNVPFPVSTLVEFVIAATDCTGQEVTDPAKCNLLAEKQYGFCKATLIHRLGGEEVSVACKLFQTQPQPANANPAGPAPTVGQAAPVAPPAGPPESVVVGPVAVPLGLPDHRTHHDLRHAFSPVASVESASGEVLHSPKVGQPGDAGAAGPVAPLCPGRVRYFKI", "length": 352, "header": "sp|P24090-1|FETUA_RAT Isoform 1 of Alpha-2-HS-glycoprotein OS=Rattus norvegicus OX=10116 GN=Ahsg PE=1 SV=2 CANONICAL=P24090-1" }, "locus": { "chromosome": "11", "start_pos": 78127926, "end_pos": 78121750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000058422", "url": "https://www.ensembl.org/id/ENSRNOT00000058422" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000055223", "url": "https://www.ensembl.org/id/ENSRNOP00000055223" } ] } }, { "isoform_ac": "Q7TP75-1", "url": "", "sequence": { "sequence": "MPSGPGGEVFGEEGEVFREEGEIFREEGEVFREEGEVFREEGEVCREEGEVCREEGEVCMEEGEVCMEEGEVCMEEGEVCREEGEVFREEGEVCMEEGEVFREEGEVCREEGEVCRKEGEVCREEGDVFREEGEVFREVGEVCMEEGEVFREEGEVLKEEGEIFREEGEVLKEEGEVCMEEGEVFREEGEVCMEEGEIFREEGEYLEGDQSTTLEESGLSGAAMKSLVLLLCFAQLWSCQSAPQGAGLGFRELACDDPETEHVALIAVDYLNKHLLQGFRQILNQIDKVKVWSRRPFGEVYELEIDTLETTCHALDPTPLANCSVRQQAEHAVEGDCDFHILKQDGQFRVLHAQCHSTPDSAEDVRKFCPRCPILIRFNDTNVVHTVKTALAAFNAQNNGTYFKLVEISRAQNVQYGFCKATLIHRLGGEEVSVACKLFQTQPQPANANPAGPAPTVGQAAPVAPPAGPPESVVVGPVAVPLGLPDHRTHHDLRHAFSPVASVESASGEVLHSPKNFFMSILSDIFYLLLLLLLLLLLLLLLLLAVVIVIVLV", "length": 553, "header": "tr|Q7TP75-1|Q7TP75_RAT Computationally mapped isoform of Alpha-2-HS-glycoprotein OS=Rattus norvegicus OX=10116 GN=Ahsg PE=1 SV=1 CANONICAL=P24090-1" }, "locus": { "chromosome": "11", "start_pos": 78145956, "end_pos": 78117921, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000078203.2", "url": "https://www.ensembl.org/id/ENSRNOT00000078203.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000073898.1", "url": "https://www.ensembl.org/id/ENSRNOP00000073898.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P24090", "database": "UniCarbKB", "url": "" }, { "id": "34106099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1039/D0MO00044B" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P24090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24090#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "P24090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24090#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 99, "start_aa": "Asn", "end_pos": 99, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn99", "evidence": [ { "id": "P24090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24090#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "site_lbl": "Ser134" }, { "start_pos": 135, "end_pos": 135, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "site_lbl": "Thr135" }, { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" }, { "database": "PubMed", "id": "16641100", "url": "https://glygen.org/publication/PubMed/16641100" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "P24090", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24090" } ], "site_lbl": "Ser138" }, { "start_pos": 309, "end_pos": 309, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "P24090", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24090" } ], "site_lbl": "Ser309" }, { "start_pos": 313, "end_pos": 313, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "phospho.ELM", "id": "P24090", "url": "http://phospho.elm.eu.org/byAccession/P24090.html" }, { "database": "iPTMnet", "id": "P24090", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24090" }, { "database": "PubMed", "id": "16396499", "url": "https://glygen.org/publication/PubMed/16396499" } ], "site_lbl": "Ser313" }, { "start_pos": 316, "end_pos": 316, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "phospho.ELM", "id": "P24090", "url": "http://phospho.elm.eu.org/byAccession/P24090.html" }, { "database": "iPTMnet", "id": "P24090", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24090" }, { "database": "PubMed", "id": "16396499", "url": "https://glygen.org/publication/PubMed/16396499" } ], "site_lbl": "Ser316" }, { "start_pos": 318, "end_pos": 318, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "phospho.ELM", "id": "P24090", "url": "http://phospho.elm.eu.org/byAccession/P24090.html" }, { "database": "iPTMnet", "id": "P24090", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24090" }, { "database": "PubMed", "id": "16396499", "url": "https://glygen.org/publication/PubMed/16396499" } ], "site_lbl": "Ser318" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "N-Glycosylation in isolated rat nerve terminals", "journal": "Molecular Omics", "date": "2021", "authors": "Matthies I., Abrahams J.L., Jensen P., Oliveira T., Kolarich D., Larsen M.R.", "evidence": [ { "database": "UniCarbKB", "id": "P24090", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1039/D0MO00044B", "url": "https://glygen.org/publication/DOI/10.1039/D0MO00044B" } ] }, { "title": "The rat protein encoded by clone pp63 is a fetuin/alpha 2-HS glycoprotein-like molecule, but is it the tyrosine kinase inhibitor pp63?", "journal": "Cell", "date": "1992", "authors": "Brown WM, Christie DL, Dziegielewska KM, Saunders NR, Yang F", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "reference": [ { "type": "PubMed", "id": "1370655", "url": "https://glygen.org/publication/PubMed/1370655" } ] }, { "title": "The nucleotide and partial amino acid sequences of rat fetuin. Identity with the natural tyrosine kinase inhibitor of the rat insulin receptor.", "journal": "Eur. J. Biochem.", "date": "1992", "authors": "Rauth G, Poschke O, Fink E, Eulitz M, Tippmer S, Kellerer M, Haring HU, Nawratil P, Haasemann M, Jahnen-Dechent W, et al.", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "reference": [ { "type": "PubMed", "id": "1371750", "url": "https://glygen.org/publication/PubMed/1371750" } ] }, { "title": "Phosphoproteomic analysis of rat liver by high capacity IMAC and LC-MS/MS.", "journal": "Journal of proteome research", "date": "2006", "authors": "Moser K, White FM", "evidence": [ { "database": "iPTMnet", "id": "P24090", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24090" } ], "reference": [ { "type": "PubMed", "id": "16396499", "url": "https://glygen.org/publication/PubMed/16396499" } ] }, { "title": "Quantitative phosphoproteomics of vasopressin-sensitive renal cells: regulation of aquaporin-2 phosphorylation at two sites.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Hoffert JD, Pisitkun T, Wang G, Shen RF, Knepper MA", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" }, { "database": "UniProtKB", "id": "F1LM19", "url": "https://www.uniprot.org/uniprot/F1LM19" }, { "database": "UniProtKB", "id": "Q7TP75", "url": "https://www.uniprot.org/uniprot/Q7TP75" }, { "database": "iPTMnet", "id": "P24090", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24090" } ], "reference": [ { "type": "PubMed", "id": "16641100", "url": "https://glygen.org/publication/PubMed/16641100" } ] }, { "title": "Rat tyrosine kinase inhibitor shows sequence similarity to human alpha 2-HS glycoprotein and bovine fetuin.", "journal": "Biochem. J.", "date": "1991", "authors": "Mueller-Esterl W., Haasemann M., Nawratil P.", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "reference": [ { "type": "PubMed", "id": "1707273", "url": "https://glygen.org/publication/PubMed/1707273" } ] }, { "title": "Primary structure of the rat gene encoding an inhibitor of the insulin receptor tyrosine kinase.", "journal": "Gene", "date": "1991", "authors": "Szpirer C., Patey G., Levan G., Szpirer J., Rossi V., Lahuna O., Falquerho L., Paqureau L., le Cam A.", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "reference": [ { "type": "PubMed", "id": "1849862", "url": "https://glygen.org/publication/PubMed/1849862" } ] }, { "title": "Purification, characterization, and studies on biosynthesis of a 59-kDa bone sialic acid-containing protein (BSP) from rat mandible using a monoclonal antibody. Evidence that 59-kDa BSP may be the rat counterpart of human alpha 2-HS glycoprotein and is synthesized by both hepatocytes and osteoblasts.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Ohnishi T., Arakaki N., Daikuhara Y., Hirono S., Nakamura O.", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "reference": [ { "type": "PubMed", "id": "1860865", "url": "https://glygen.org/publication/PubMed/1860865" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" }, { "database": "UniProtKB", "id": "F1LM19", "url": "https://www.uniprot.org/uniprot/F1LM19" }, { "database": "UniProtKB", "id": "Q7TP75", "url": "https://www.uniprot.org/uniprot/Q7TP75" }, { "database": "iPTMnet", "id": "P24090", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24090" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "Fetuin A promotes lipotoxicity in beta cells through the TLR4 signaling pathway and the role of pioglitazone in anti-lipotoxicity.", "journal": "Molecular and cellular endocrinology", "date": "2015", "authors": "Shen X, Yang L, Yan S, Zheng H, Liang L, Cai X, Liao M", "evidence": [ { "database": "RefSeq", "id": "NP_037030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030" } ], "reference": [ { "type": "PubMed", "id": "25986658", "url": "https://glygen.org/publication/PubMed/25986658" } ] }, { "title": "Facilitatory effects of fetuin-A on atherosclerosis.", "journal": "Atherosclerosis", "date": "2016", "authors": "Naito C, Hashimoto M, Watanabe K, Shirai R, Takahashi Y, Kojima M, Watanabe R, Sato K, Iso Y, Matsuyama TA, Suzuki H, Ishibashi-Ueda H, Watanabe T", "evidence": [ { "database": "RefSeq", "id": "NP_037030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030" } ], "reference": [ { "type": "PubMed", "id": "26828753", "url": "https://glygen.org/publication/PubMed/26828753" } ] }, { "title": "Characterization of a natural inhibitor of the insulin receptor tyrosine kinase: cDNA cloning, purification, and anti-mitogenic activity.", "journal": "Cell", "date": "1989", "authors": "Pages G., Auberger P., Rossi B., Contreres J.O., Falquerho L., le Cam A., le Cam G.", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "reference": [ { "type": "PubMed", "id": "2766355", "url": "https://glygen.org/publication/PubMed/2766355" } ] }, { "title": "N-Glycosylation in isolated rat nerve terminals.", "journal": "Molecular omics", "date": "2021", "authors": "Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR", "evidence": [ { "database": "UniCarbKB", "id": "P24090", "url": "" } ], "reference": [ { "type": "PubMed", "id": "34106099", "url": "https://glygen.org/publication/PubMed/34106099" } ] }, { "title": "Fetuin-A Deficiency but Not Pentraxin 3, FGF-21, or Irisin, Predisposes to More Serious COVID-19 Course.", "journal": "Biomolecules", "date": "2021", "authors": "Kukla M, Menzyk T, Dembinski M, Winiarski M, Garlicki A, Bociaga-Jasik M, Skonieczna M, Hudy D, Maziarz B, Kusnierz-Cabala B, Kapusta M, Skladany L, Grgurevic I, Mikolasevic I, Filipec-Kanizaj T, Wojcik-Bugajska M, Grodzicki T, Rogula T, Stygar D", "evidence": [ { "database": "RefSeq", "id": "NP_037030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_037030" } ], "reference": [ { "type": "PubMed", "id": "34680053", "url": "https://glygen.org/publication/PubMed/34680053" } ] }, { "title": "Molecular cloning and sequence analysis of cDNA for a 59 kD bone sialoprotein of the rat: demonstration that it is a counterpart of human alpha 2-HS glycoprotein and bovine fetuin.", "journal": "J. Bone Miner. Res.", "date": "1993", "authors": "Ohnishi T., Muramatsu T., Ozawa M., Arakaki N., Daikuhara Y., Nakamura O.", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "reference": [ { "type": "PubMed", "id": "7681247", "url": "https://glygen.org/publication/PubMed/7681247" } ] } ], "pathway": [ { "id": "rno:25373", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:25373", "resource": "KEGG Pathway" }, { "id": "R-RNO-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-RNO-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-RNO-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-RNO-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" } ], "orthologs": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV", "length": 367 }, "evidence": [ { "id": "45226924", "url": "http://www.informatics.jax.org/homology/45226924", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P29699-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "Ahsg", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKSLVLLLCFAQLWGCQSAPQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKI", "length": 345 }, "evidence": [ { "id": "45226924", "url": "http://www.informatics.jax.org/homology/45226924", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "cysteine-type endopeptidase inhibitor activity", "id": "GO:0004869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004869", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "endopeptidase inhibitor activity", "id": "GO:0004866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004866", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "receptor signaling protein tyrosine kinase inhibitor activity", "id": "GO:0030294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030294", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "kinase inhibitor activity", "id": "GO:0019210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019210", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "negative regulation of endopeptidase activity", "id": "GO:0010951", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010951", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "negative regulation of insulin receptor signaling pathway", "id": "GO:0046627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046627", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "cellular response to insulin stimulus", "id": "GO:0032869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032869", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "acute-phase response", "id": "GO:0006953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006953", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "cerebral cortex development", "id": "GO:0021987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021987", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "positive regulation of bone resorption", "id": "GO:0045780", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045780", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "male gonad development", "id": "GO:0008584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008584", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "negative regulation of cell growth", "id": "GO:0030308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030308", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "regulation of inflammatory response", "id": "GO:0050727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050727", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "positive regulation of phagocytosis", "id": "GO:0050766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050766", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "animal organ regeneration", "id": "GO:0031100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031100", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "ossification", "id": "GO:0001503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001503", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "negative regulation of bone mineralization", "id": "GO:0030502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030502", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" }, { "name": "protein-containing complex assembly", "id": "GO:0065003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0065003", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 156, "end_pos": 158, "annotation": "n_glycosylation_sequon" }, { "start_pos": 176, "end_pos": 178, "annotation": "n_glycosylation_sequon" }, { "start_pos": 99, "end_pos": 101, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by FAM20C in the extracellular medium.", "evidence": [ { "database": "UniProtKB", "id": "P24090", "url": "https://www.uniprot.org/uniprot/P24090" }, { "database": "PubMed", "id": "P02765", "url": "https://glygen.org/publication/PubMed/P02765" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }