{ "uniprot_canonical_ac": "P22727-1", "uniprot_ac": "P22727", "uniprot_id": "WNT6_MOUSE", "mass": { "chemical_mass": 39656.0, "monoisotopic_mass": 39656.0 }, "refseq": { "ac": "NP_033552", "name": "protein Wnt-6 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552" }, "gene_names": [ { "name": "Wnt6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P22727", "id": "P22727" }, { "name": "Wnt-6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552", "id": "NP_033552" }, { "name": "Wnt-6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P22727", "id": "P22727" }, { "name": "Wnt6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552", "id": "NP_033552" } ], "protein_names": [ { "name": "Protein Wnt-6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P22727" }, { "name": "protein Wnt-6 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552", "id": "NP_033552" }, { "name": "protein Wnt-6; wingless-related MMTV integration site 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552", "id": "NP_033552" } ], "function": [ { "annotation": "Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727#function" } ] }, { "annotation": "Role of TGFbeta1 and WNT6 in FGF2 and BMP4-driven endothelial differentiation of murine embryonic stem cells.", "evidence": [ { "database": "RefSeq", "id": "NP_033552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552" }, { "database": "PubMed", "id": "34478025", "url": "https://glygen.org/publication/PubMed/34478025" } ] }, { "annotation": "WNT6/ACC2-induced storage of triacylglycerols in macrophages is exploited by Mycobacterium tuberculosis.", "evidence": [ { "database": "RefSeq", "id": "NP_033552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552" }, { "database": "PubMed", "id": "34255743", "url": "https://glygen.org/publication/PubMed/34255743" } ] }, { "annotation": "Wnt6 plays a complex role in maintaining human limbal stem/progenitor cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_033552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552" }, { "database": "PubMed", "id": "34686698", "url": "https://glygen.org/publication/PubMed/34686698" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Wnt6", "url": "https://www.uniprot.org/uniprot/P22727", "locus": { "chromosome": "1", "start_pos": 74824481, "end_pos": 74811051, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000033227", "url": "https://www.ensembl.org/id/ENSMUSG00000033227" } ] } } ], "crossref": [ { "id": "ENSMUSG00000033227", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000033227", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19338", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19338", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "22420", "url": "https://www.ncbi.nlm.nih.gov/gene/22420", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P22727", "url": "https://www.ebi.ac.uk/intact/interactors/id:P22727*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005817", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005817", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009143", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009143", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018161", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018161", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043158", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043158", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:22420", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22420", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "98960", "url": "http://www.informatics.jax.org/marker/MGI:98960", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "EWTNCNC", "url": "https://omabrowser.org/oma/group/EWTNCNC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2874082at2759", "url": "http://www.orthodb.org/?query=2874082at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12027", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12027", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12027:SF72", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12027:SF72", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00110", "url": "http://pfam.xfam.org/family/PF00110", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P22727", "url": "http://purl.obolibrary.org/obo/PR_P22727", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3238698", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_033552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P22727-1", "url": "https://www.uniprot.org/uniprot/P22727-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLPPVPSRLGLLLLLLCPAHVDGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL", "length": 364, "header": "sp|P22727-1|WNT6_MOUSE Isoform 1 of Protein Wnt-6 OS=Mus musculus OX=10090 GN=Wnt6 PE=1 SV=2 CANONICAL=P22727-1" }, "isoforms": [ { "isoform_ac": "P22727-1", "url": "", "sequence": { "sequence": "MLPPVPSRLGLLLLLLCPAHVDGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL", "length": 364, "header": "sp|P22727-1|WNT6_MOUSE Isoform 1 of Protein Wnt-6 OS=Mus musculus OX=10090 GN=Wnt6 PE=1 SV=2 CANONICAL=P22727-1" }, "locus": { "chromosome": "1", "start_pos": 74823756, "end_pos": 74811305, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000006716", "url": "https://www.ensembl.org/id/ENSMUST00000006716" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000006716", "url": "https://www.ensembl.org/id/ENSMUSP00000006716" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 310, "start_aa": "Asn", "end_pos": 310, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn310", "evidence": [ { "id": "P22727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22727#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "P22727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22727#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.", "journal": "Eur. J. Biochem.", "date": "2000", "authors": "Tanaka K, Okabayashi K, Asashima M, Perrimon N, Kadowaki T", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "reference": [ { "type": "PubMed", "id": "10866835", "url": "https://glygen.org/publication/PubMed/10866835" } ] }, { "title": "WNT6 is a novel target gene of caveolin-1 promoting chemoresistance to epirubicin in human gastric cancer cells.", "journal": "Oncogene", "date": "2013", "authors": "Zimmermann W., Yuan G., Friedrich T., Langer R., Roecken C., Keller G., Schmid R.M., Burgermeister E., Stroebel P., Ebert M.P.A., Hitkova I., Hofheinz R.D., Lian F., Regel I.", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "reference": [ { "type": "PubMed", "id": "22370641", "url": "https://glygen.org/publication/PubMed/22370641" } ] }, { "title": "Expression of multiple novel Wnt-1/int-1-related genes during fetal and adult mouse development.", "journal": "Genes Dev.", "date": "1990", "authors": "Gavin BJ, McMahon JA, McMahon AP", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "reference": [ { "type": "PubMed", "id": "2279700", "url": "https://glygen.org/publication/PubMed/2279700" } ] }, { "title": "WNT6/ACC2-induced storage of triacylglycerols in macrophages is exploited by Mycobacterium tuberculosis.", "journal": "The Journal of clinical investigation", "date": "2021", "authors": "Brandenburg J, Marwitz S, Tazoll SC, Waldow F, Kalsdorf B, Vierbuchen T, Scholzen T, Gross A, Goldenbaum S, Holscher A, Hein M, Linnemann L, Reimann M, Kispert A, Leitges M, Rupp J, Lange C, Niemann S, Behrends J, Goldmann T, Heine H, Schaible UE, Holscher C, Schwudke D, Reiling N", "evidence": [ { "database": "RefSeq", "id": "NP_033552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552" } ], "reference": [ { "type": "PubMed", "id": "34255743", "url": "https://glygen.org/publication/PubMed/34255743" } ] }, { "title": "Role of TGFbeta1 and WNT6 in FGF2 and BMP4-driven endothelial differentiation of murine embryonic stem cells.", "journal": "Angiogenesis", "date": "2022", "authors": "Gualandris A, Noghero A, Cora' D, Astanina E, Arese M, Bussolino F", "evidence": [ { "database": "RefSeq", "id": "NP_033552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552" } ], "reference": [ { "type": "PubMed", "id": "34478025", "url": "https://glygen.org/publication/PubMed/34478025" } ] }, { "title": "Wnt6 plays a complex role in maintaining human limbal stem/progenitor cells.", "journal": "Scientific reports", "date": "2021", "authors": "Bonnet C, Oh D, Mei H, Robertson S, Chang D, Bourges JL, Behar-Cohen F, Zheng JJ, Deng SX", "evidence": [ { "database": "RefSeq", "id": "NP_033552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033552" } ], "reference": [ { "type": "PubMed", "id": "34686698", "url": "https://glygen.org/publication/PubMed/34686698" } ] } ], "pathway": [ { "id": "mmu:22420", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22420", "resource": "KEGG Pathway" }, { "id": "R-MMU-3238698", "name": "WNT ligand biogenesis and trafficking", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3238698", "resource": "Reactome", "description": "WNT ligand biogenesis and trafficking" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9Y6F9-1", "protein_name": "Protein Wnt-6", "gene_name": "WNT6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL", "length": 365 }, "evidence": [ { "id": "45231374", "url": "http://www.informatics.jax.org/homology/45231374", "database": "MGI" }, { "id": "P22727", "url": "https://omabrowser.org/oma/group/P22727/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "axis specification", "id": "GO:0009798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009798", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "animal organ morphogenesis", "id": "GO:0009887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009887", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "Wnt signaling pathway", "id": "GO:0016055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016055", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "odontogenesis of dentin-containing tooth", "id": "GO:0042475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042475", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "canonical Wnt signaling pathway", "id": "GO:0060070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060070", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "positive regulation of tooth mineralization", "id": "GO:0070172", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070172", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "branching involved in ureteric bud morphogenesis", "id": "GO:0001658", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001658", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "cell fate commitment", "id": "GO:0045165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045165", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "epithelial-mesenchymal cell signaling", "id": "GO:0060684", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060684", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "nephron tubule formation", "id": "GO:0072079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072079", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "nephron tubule development", "id": "GO:0072080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072080", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "frizzled binding", "id": "GO:0005109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005109", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 310, "end_pos": 312, "annotation": "n_glycosylation_sequon" }, { "start_pos": 85, "end_pos": 87, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Palmitoleoylation is required for efficient binding to frizzled receptors. Depalmitoleoylation leads to Wnt signaling pathway inhibition.", "evidence": [ { "database": "UniProtKB", "id": "P22727", "url": "https://www.uniprot.org/uniprot/P22727" }, { "database": "PubMed", "id": "P56704", "url": "https://glygen.org/publication/PubMed/P56704" }, { "database": "PubMed", "id": "P27467", "url": "https://glygen.org/publication/PubMed/P27467" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }