{ "uniprot_canonical_ac": "P22469-1", "uniprot_ac": "P22469", "uniprot_id": "Z600_DROME", "mass": { "chemical_mass": 10530.0, "monoisotopic_mass": 10530.0 }, "refseq": { "ac": "NP_524083", "name": "Z600", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524083" }, "gene_names": [ { "name": "Z600", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P22469", "id": "P22469" }, { "name": "3.2; CG17962; Dmel\\CG17962; DMZ60MEX; frs; Frs; z600", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524083", "id": "NP_524083" }, { "name": "CG17962", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P22469", "id": "P22469" }, { "name": "Z600", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524083", "id": "NP_524083" }, { "name": "frs", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P22469", "id": "P22469" } ], "protein_names": [ { "name": "Protein Z600", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P22469" }, { "name": "CG17962-PA; Z600-PA; frustart; fruhstart", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524083", "id": "NP_524083" }, { "name": "Protein Fruhstart", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P22469" }, { "name": "Z600", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524083", "id": "NP_524083" } ], "function": [ { "annotation": "Cell cycle regulator that is involved in modulating and adjusting cell proliferation according to the requirements of the developmental program (PubMed:10850494, PubMed:12919679, PubMed:17431409). Interacts with mitotic Cdk1-cyclin complexes to inhibit mitotic entry at the G2/M transition (PubMed:17431409). Likely to function by binding to the hydrophobic patch of cyclins to interfere with the interaction between the complex and certain Cdk1 substrates (PubMed:17431409). At the mid-blastula transition, involved in the cell cycle arrest in G2 of cycle 14 by delaying mitosis and thus reducing cell proliferation allowing cell fate specification and morphogenesis to take place (PubMed:12919679). Acts downstream or in parallel to the checkpoint regulator grp which is also required for the cell cycle pause at cycle 14 (PubMed:12919679). During gastrulation, delays mitosis in the ventral region of the embryonic mesoderm thus allowing invagination to be completed before cell division takes place (PubMed:10850494, PubMed:12919679, PubMed:17431409).", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469#function" }, { "database": "PubMed", "id": "10850494", "url": "https://glygen.org/publication/PubMed/10850494" }, { "database": "PubMed", "id": "12919679", "url": "https://glygen.org/publication/PubMed/12919679" }, { "database": "PubMed", "id": "17431409", "url": "https://glygen.org/publication/PubMed/17431409" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 86, "end_pos": 86, "sequence_org": "K", "sequence_mut": "A", "comment": "No ventral furrow formation during gastrulation and reduced binding to CycA; when associated with A-88.", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" }, { "database": "PubMed", "id": "17431409", "url": "https://glygen.org/publication/PubMed/17431409" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "L", "sequence_mut": "A", "comment": "No ventral furrow formation during gastrulation and reduced binding to CycA; when associated with A-86.", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" }, { "database": "PubMed", "id": "17431409", "url": "https://glygen.org/publication/PubMed/17431409" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Z600", "url": "https://www.uniprot.org/uniprot/P22469", "locus": { "chromosome": "3L", "start_pos": 15509513, "end_pos": 15509061, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0004052", "url": "https://www.ensembl.org/id/FBgn0004052" } ] } } ], "crossref": [ { "id": "FBgn0004052", "url": "https://bgee.org/?page=gene&gene_id=FBgn0004052", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0004052", "url": "https://flybase.org/reports/FBgn0004052", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "39673", "url": "https://www.ncbi.nlm.nih.gov/gene/39673", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P22469", "url": "https://www.ebi.ac.uk/intact/interactors/id:P22469*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "dme:Dmel_CG17962", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG17962", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KRECYSE", "url": "https://omabrowser.org/oma/group/KRECYSE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3525777at2759", "url": "http://www.orthodb.org/?query=3525777at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_P22469", "url": "http://purl.obolibrary.org/obo/PR_P22469", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_524083", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524083", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P22469-1", "url": "https://www.uniprot.org/uniprot/P22469-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPSSSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF", "length": 90, "header": "sp|P22469-1|Z600_DROME Isoform 1 of Protein Z600 OS=Drosophila melanogaster OX=7227 GN=Z600 PE=1 SV=2 CANONICAL=P22469-1" }, "isoforms": [ { "isoform_ac": "P22469-1", "url": "", "sequence": { "sequence": "MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPSSSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF", "length": 90, "header": "sp|P22469-1|Z600_DROME Isoform 1 of Protein Z600 OS=Drosophila melanogaster OX=7227 GN=Z600 PE=1 SV=2 CANONICAL=P22469-1" }, "locus": { "chromosome": "3L", "start_pos": 15509393, "end_pos": 15509124, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0075549", "url": "https://www.ensembl.org/id/FBtr0075549" }, { "database": "Ensembl Peptide", "id": "FBpp0075304", "url": "https://www.ensembl.org/id/FBpp0075304" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" }, { "database": "PubMed", "id": "17431409", "url": "https://glygen.org/publication/PubMed/17431409" }, { "database": "iPTMnet", "id": "P22469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22469" } ], "site_lbl": "Thr22" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "PubMed", "id": "17431409", "url": "https://glygen.org/publication/PubMed/17431409" }, { "database": "phospho.ELM", "id": "P22469", "url": "http://phospho.elm.eu.org/byAccession/P22469.html" }, { "database": "iPTMnet", "id": "P22469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22469" } ], "site_lbl": "Thr48" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "A genetic link between morphogenesis and cell division during formation of the ventral furrow in Drosophila.", "journal": "Cell", "date": "2000", "authors": "Grosshans J, Wieschaus E", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "reference": [ { "type": "PubMed", "id": "10850494", "url": "https://glygen.org/publication/PubMed/10850494" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Control of cleavage cycles in Drosophila embryos by fruhstart.", "journal": "Dev. Cell", "date": "2003", "authors": "Wieschaus E., Grosshans J., Mueller H.A.J.", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "reference": [ { "type": "PubMed", "id": "12919679", "url": "https://glygen.org/publication/PubMed/12919679" } ] }, { "title": "The Drosophila mitotic inhibitor Fruhstart specifically binds to the hydrophobic patch of cyclins.", "journal": "EMBO reports", "date": "2007", "authors": "Gawlinski P, Nikolay R, Goursot C, Lawo S, Chaurasia B, Herz HM, Kussler-Schneider Y, Ruppert T, Mayer M, Grosshans J", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" }, { "database": "iPTMnet", "id": "P22469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22469" } ], "reference": [ { "type": "PubMed", "id": "17431409", "url": "https://glygen.org/publication/PubMed/17431409" } ] }, { "title": "Phosphoproteome analysis of Drosophila melanogaster embryos.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zhai B, Villen J, Beausoleil SA, Mintseris J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" }, { "database": "iPTMnet", "id": "P22469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22469" } ], "reference": [ { "type": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" } ] }, { "title": "The Drosophila melanogaster z600 gene encodes a chromatin-associated protein synthesized in the syncytial blastoderm.", "journal": "Gene", "date": "1990", "authors": "Schulz R.A., Galewsky S., Xie X.L.", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "reference": [ { "type": "PubMed", "id": "2125289", "url": "https://glygen.org/publication/PubMed/2125289" } ] }, { "title": "Dorsal expression of the Drosophila z600 gene during early embryogenesis.", "journal": "Dev. Biol.", "date": "1989", "authors": "Schulz R.A., Miksch J.L.", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "reference": [ { "type": "PubMed", "id": "2478402", "url": "https://glygen.org/publication/PubMed/2478402" } ] }, { "title": "Overlapping genes of Drosophila melanogaster: organization of the z600-gonadal-Eip28/29 gene cluster.", "journal": "Genes Dev.", "date": "1989", "authors": "Schulz R.A., Butler B.A.", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "reference": [ { "type": "PubMed", "id": "2497054", "url": "https://glygen.org/publication/PubMed/2497054" } ] } ], "pathway": [ { "id": "dme:Dmel_CG17962", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG17962", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" }, { "name": "cell cycle", "id": "GO:0007049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" }, { "name": "negative regulation of mitotic nuclear division", "id": "GO:0045839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045839", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" }, { "name": "gastrulation", "id": "GO:0007369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007369", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" }, { "name": "negative regulation of G2/M transition of mitotic cell cycle", "id": "GO:0010972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010972", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" }, { "name": "ventral furrow formation", "id": "GO:0007370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007370", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cyclin binding", "id": "GO:0030332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030332", "evidence": [ { "database": "UniProtKB", "id": "P22469", "url": "https://www.uniprot.org/uniprot/P22469" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }