{ "uniprot_canonical_ac": "P22283-1", "uniprot_ac": "P22283", "uniprot_id": "22P2_RAT", "mass": { "chemical_mass": 21013.0, "monoisotopic_mass": 21013.0 }, "refseq": { "ac": "NP_954887", "name": "cystatin-related protein 2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954887" }, "gene_names": [ { "name": "Crp2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P22283", "id": "P22283" }, { "name": "P22k15", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P22283", "id": "P22283" }, { "name": "Crp2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954887", "id": "NP_954887" }, { "name": "P22k15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954887", "id": "NP_954887" }, { "name": "P22k15", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P22283", "id": "P22283" } ], "protein_names": [ { "name": "Cystatin-related protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P22283" }, { "name": "Prostatic 22 kDa glycoprotein P22K15", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P22283" }, { "name": "cystatin-related protein 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954887", "id": "NP_954887" }, { "name": "prostatic 22 kDa glycoprotein P22K15; prostatic 22-kD glycoprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954887", "id": "NP_954887" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "common_name": "Rat" } ], "gene": [ { "name": "Crp2", "url": "https://www.uniprot.org/uniprot/P22283", "locus": {} } ], "crossref": [ { "id": "cd00042", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00042", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "296229", "url": "https://www.ncbi.nlm.nih.gov/gene/296229", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000010", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000010", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046350", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046350", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:296229", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:296229", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "4851213at2759", "url": "http://www.orthodb.org/?query=4851213at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46186", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46186", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46186:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46186:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_P22283", "url": "http://purl.obolibrary.org/obo/PR_P22283", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_954887", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954887", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "727814", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=727814", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P22283-1", "url": "https://www.uniprot.org/uniprot/P22283-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Z4YNX7", "url": "https://www.uniprot.org/uniprot/Z4YNX7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Z4YNX7-1", "url": "https://www.uniprot.org/uniprot/Z4YNX7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYKTLCGTQLLLAIFVLFLNFSHATAKGTRGPMEIFKKNFMEKNKLNDVYDIFKFLYNKFSHDTYLSNIKNQSFTMNTWGFGEIEVVKTKCRKIDSDFYKCSFQWEFCNIKRTPGVTIYYITLPGSVRCRKLLSKLVNCPFEEQTEQLKREICYFQLYPDYIEQNIRSVRFNCYTK", "length": 176, "header": "sp|P22283-1|22P2_RAT Isoform 1 of Cystatin-related protein 2 OS=Rattus norvegicus OX=10116 GN=Crp2 PE=2 SV=1 CANONICAL=P22283-1" }, "isoforms": [ { "isoform_ac": "P22283-1", "url": "", "sequence": { "sequence": "MYKTLCGTQLLLAIFVLFLNFSHATAKGTRGPMEIFKKNFMEKNKLNDVYDIFKFLYNKFSHDTYLSNIKNQSFTMNTWGFGEIEVVKTKCRKIDSDFYKCSFQWEFCNIKRTPGVTIYYITLPGSVRCRKLLSKLVNCPFEEQTEQLKREICYFQLYPDYIEQNIRSVRFNCYTK", "length": 176, "header": "sp|P22283-1|22P2_RAT Isoform 1 of Cystatin-related protein 2 OS=Rattus norvegicus OX=10116 GN=Crp2 PE=2 SV=1 CANONICAL=P22283-1" }, "locus": { "chromosome": "3", "start_pos": 136967338, "end_pos": 136961192, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000050369", "url": "https://www.ensembl.org/id/ENSRNOT00000050369" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000043921", "url": "https://www.ensembl.org/id/ENSRNOP00000043921" } ] } }, { "isoform_ac": "Z4YNX7-1", "url": "", "sequence": { "sequence": "MCKTLCGTLLLLAIFVLFLNFNHATAKSTMGGIEMFARNFMEKNKLNDVYDVFKYLYNKYSDDPYLSNIKNQSFTMITWGFGEIEVVKTKCRKIDSDFYKCSFQWEFCNIKRTPGVTIYYITLPGSVRCRKLLSKLVNCPFEEQTEQLKREICYFQLYPDYIEQNIRSVRFNCYTK", "length": 176, "header": "tr|Z4YNX7-1|Z4YNX7_RAT Computationally mapped isoform of Cystatin-related protein 2 OS=Rattus norvegicus OX=10116 GN=P22k15 PE=4 SV=2 CANONICAL=P22283-1" }, "locus": { "chromosome": "3", "start_pos": 136967338, "end_pos": 136961192, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000050369", "url": "https://www.ensembl.org/id/ENSRNOT00000050369" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000043921", "url": "https://www.ensembl.org/id/ENSRNOP00000043921" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "P22283", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22283#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Tissue-specific expression and androgen regulation of different genes encoding rat prostatic 22-kilodalton glycoproteins homologous to human and rat cystatin.", "journal": "Mol. Endocrinol.", "date": "1990", "authors": "Heyns W., Verhoeven G., Peeters B., Rombauts W., Winderickx J., Hemschoote K., de Clercq N., van Dijck P.", "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "reference": [ { "type": "PubMed", "id": "2280780", "url": "https://glygen.org/publication/PubMed/2280780" } ] }, { "title": "An effect of androgens on the length of the poly(A)-tail and alternative splicing cause size heterogeneity of the messenger ribonucleic acids encoding cystatin-related protein.", "journal": "Endocrinology", "date": "1992", "authors": "Heyns W., Peeters B., Winderickx J., Devos A., Vercaeren I.", "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "reference": [ { "type": "PubMed", "id": "7679983", "url": "https://glygen.org/publication/PubMed/7679983" } ] }, { "title": "Structure of rat genes encoding androgen-regulated cystatin-related proteins (CRPs): a new member of the cystatin superfamily.", "journal": "Gene", "date": "1993", "authors": "Devos A, De Clercq N, Vercaeren I, Heyns W, Rombauts W, Peeters B", "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "reference": [ { "type": "PubMed", "id": "8462870", "url": "https://glygen.org/publication/PubMed/8462870" } ] } ], "pathway": [ { "id": "rno:296229", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:296229", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P22282-1", "protein_name": "Cystatin-related protein 1", "gene_name": "Andpro", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCKTLHGTLLLLAIFVLFLNFSHATAKRTRRGMEIFEKNFIDKNKLKDVYDVFKYLYNTHSADTYLSNIKNESFTMNIWGFGEIEMVKTKCRKIDSDFYKCSFQREFYNLKRTPGETMYYISLPGSVRCRKLLSKLDNCPFEEQTEQLKREICYFVVYPDYIEQNIHAVRFDCYTK", "length": 176 }, "evidence": [ { "id": "45244665", "url": "http://www.informatics.jax.org/homology/45244665", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cysteine-type endopeptidase inhibitor activity", "id": "GO:0004869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004869", "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "negative regulation of cysteine-type endopeptidase activity", "id": "GO:2000117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000117", "evidence": [ { "database": "UniProtKB", "id": "P22283", "url": "https://www.uniprot.org/uniprot/P22283" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 20, "end_pos": 22, "annotation": "n_glycosylation_sequon" }, { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }