{ "uniprot_canonical_ac": "P20485-1", "uniprot_ac": "P20485", "uniprot_id": "KICH_YEAST", "mass": { "chemical_mass": 66317.0, "monoisotopic_mass": 66317.0 }, "refseq": { "ac": "NP_013234", "name": "bifunctional choline kinase/ethanolamine kinase CKI1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013234" }, "gene_names": [ { "name": "CKI1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P20485", "id": "P20485" }, { "name": "CKI1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013234", "id": "NP_013234" }, { "name": "CKI", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20485", "id": "P20485" }, { "name": "L3130", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20485", "id": "P20485" }, { "name": "L9606.8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20485", "id": "P20485" } ], "protein_names": [ { "name": "Choline kinase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P20485" }, { "name": "2.7.1.32", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P20485" }, { "name": "ATP:choline phosphotransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P20485" }, { "name": "bifunctional choline kinase/ethanolamine kinase CKI1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013234", "id": "NP_013234" } ], "function": [ { "annotation": "Catalyzes the committed step in the synthesis of phosphatidylcholine by the CDP-choline pathway (PubMed:2536698, PubMed:9506987, PubMed:10329685). Also exhibits ethanolamine kinase activity but it is a poor substrate at 14% efficiency compared with choline (PubMed:2536698, PubMed:9506987).", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485#function" }, { "database": "PubMed", "id": "9506987", "url": "https://glygen.org/publication/PubMed/9506987" }, { "database": "PubMed", "id": "2536698", "url": "https://glygen.org/publication/PubMed/2536698" }, { "database": "PubMed", "id": "10329685", "url": "https://glygen.org/publication/PubMed/10329685" } ] } ], "disease": [ { "disease_id": "DOID:0050912", "recommended_name": { "id": "DOID:0050912", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050912", "name": "colon adenoma", "description": "A colonic benign neoplasm that has_material_basis_in epithelial tissue with glandular origin." }, "synonyms": [], "evidence": [ { "id": "0050912", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050912" } ] }, { "disease_id": "DOID:0110632", "recommended_name": { "id": "DOID:0110632", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110632", "name": "megaconial type congenital muscular dystrophy", "description": "A congenital muscular dystrophy characterized by autosomal recessive inheritance of early-onset muscle wasting and intellectual disability with enlarged mitochondria that are more prevalent towards the periphery of the fibers that has_material_basis_in homozygous or compound heterozygous mutation in the CHKB gene on chromosome 22q13." }, "synonyms": [ { "id": "DOID:0110632", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110632", "name": "congenital megaconial myopathy", "description": "" }, { "id": "DOID:0110632", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110632", "name": "megaconial congenital muscular dystrophy", "description": "" }, { "id": "DOID:0110632", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110632", "name": "congenital muscular dystrophy due to phosphatidylcholine biosynthesis defect", "description": "" }, { "id": "DOID:0110632", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110632", "name": "congenital muscular dystrophy with mitochondrial structural abnormalities", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "megaconial type congenital muscular dystrophy", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "congenital megaconial myopathy", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "congenital muscular dystrophy due to phosphatidylcholine biosynthesis defect", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "congenital muscular dystrophy with mitochondrial structural abnormalities", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "megaconial congenital muscular dystrophy", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "megaconial type congenital muscular dystrophy", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "MDCMC", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "megaconial congnital muscular dystrophy", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "muscular dystrophy, congenital, megaconial type", "description": "" }, { "id": "MONDO:0011246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011246", "name": "muscular dystrophy, congenital, with mitochondrial structural abnormalities", "description": "" }, { "id": "MIM:602541", "resource": "MIM", "url": "https://www.omim.org/entry/602541", "name": "Muscular dystrophy, congenital, megaconial type", "description": "Muscular dystrophy, congenital, megaconial type" } ], "evidence": [ { "id": "0110632", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110632" } ] }, { "disease_id": "DOID:1059", "recommended_name": { "id": "DOID:1059", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1059", "name": "intellectual disability", "description": "A specific developmental disorder that involves significant limitations both in mental functioning and in adaptive behavior such as communicating, taking care of him or herself, and social skills." }, "synonyms": [], "evidence": [ { "id": "1059", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1059" } ] }, { "disease_id": "DOID:10907", "recommended_name": { "id": "DOID:10907", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10907", "name": "microcephaly", "description": "A congenital nervous system abnormality that is characterized by a significantly smaller than normal head in infants." }, "synonyms": [ { "id": "DOID:10907", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10907", "name": "Microcephalus", "description": "" }, { "id": "DOID:10907", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10907", "name": "microencephaly", "description": "" } ], "evidence": [ { "id": "10907", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10907" } ] }, { "disease_id": "DOID:1826", "recommended_name": { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy", "description": "A brain disease that is characterized by the occurrance of at least two unprovoked seizures resulting from a persistent epileptogenic abnormality of the brain that is able to spontaneously generate paroxysmal activity and typically manifested by sudden brief episodes of altered or diminished consciousness, involuntary movements, or convulsions." }, "synonyms": [ { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy syndrome", "description": "" }, { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epileptic syndrome", "description": "" } ], "evidence": [ { "id": "1826", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1826" } ] }, { "disease_id": "DOID:219", "recommended_name": { "id": "DOID:219", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:219", "name": "colon cancer", "description": "A colorectal cancer that is located_in the colon." }, "synonyms": [], "evidence": [ { "id": "219", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:219" } ] }, { "disease_id": "DOID:224", "recommended_name": { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient cerebral ischemia", "description": "A brain ischemia that is characterized by ischemia of brief duration and without resultant tissue death." }, "synonyms": [ { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA - Transient ischaemic attack", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient cerebral ischaemia", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient ischemic attacks", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient ischemic attack", "description": "" } ], "evidence": [ { "id": "224", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:224" } ] }, { "disease_id": "DOID:8619", "recommended_name": { "id": "DOID:8619", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8619", "name": "recurrent hypersomnia", "description": "A sleep disorder that involves recurring bouts of excessive amounts of sleepiness." }, "synonyms": [ { "id": "DOID:8619", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8619", "name": "primary recurrent hypersomnia", "description": "" } ], "evidence": [ { "id": "8619", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8619" } ] }, { "disease_id": "DOID:8986", "recommended_name": { "id": "DOID:8986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8986", "name": "narcolepsy", "description": "A sleep disorder that involves an excessive urge to sleep at inappropriate times, such as while at work." }, "synonyms": [ { "id": "DOID:8986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8986", "name": "Narcolepsy, without cataplexy", "description": "" }, { "id": "DOID:8986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8986", "name": "paroxysmal sleep", "description": "" }, { "id": "MONDO:0013652", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013652", "name": "narcolepsy 7", "description": "Any narcolepsy in which the cause of the disease is a mutation in the MOG gene." }, { "id": "MONDO:0013652", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013652", "name": "MOG narcolepsy", "description": "" }, { "id": "MONDO:0013652", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013652", "name": "narcolepsy 7", "description": "" }, { "id": "MONDO:0013652", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013652", "name": "narcolepsy caused by mutation in MOG", "description": "" }, { "id": "MONDO:0013652", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013652", "name": "narcolepsy type 7", "description": "" }, { "id": "MONDO:0013652", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013652", "name": "NRCLP7", "description": "" }, { "id": "MONDO:0011607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011607", "name": "narcolepsy 2, susceptibility to", "description": "" }, { "id": "MONDO:0011607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011607", "name": "NRCLP2", "description": "" }, { "id": "MONDO:0011607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011607", "name": "narcolepsy 2, susceptibility to", "description": "" }, { "id": "MONDO:0011607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011607", "name": "narcolepsy 2", "description": "" }, { "id": "MONDO:0013020", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013020", "name": "narcolepsy 5, susceptibility to", "description": "" }, { "id": "MONDO:0013020", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013020", "name": "NRCLP5", "description": "" }, { "id": "MONDO:0013020", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013020", "name": "narcolepsy 5, susceptibility to", "description": "" }, { "id": "MONDO:0013020", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013020", "name": "narcolepsy 5", "description": "" }, { "id": "MONDO:0012898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012898", "name": "narcolepsy 4, susceptibility to", "description": "" }, { "id": "MONDO:0012898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012898", "name": "NRCLP4", "description": "" }, { "id": "MONDO:0012898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012898", "name": "narcolepsy 4, susceptibility to", "description": "" }, { "id": "MONDO:0012898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012898", "name": "narcolepsy 4", "description": "" }, { "id": "MONDO:0012179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012179", "name": "narcolepsy 3", "description": "" }, { "id": "MONDO:0012179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012179", "name": "NRCLP3", "description": "" }, { "id": "MONDO:0012179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012179", "name": "narcolepsy 3", "description": "" }, { "id": "MONDO:0013639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013639", "name": "narcolepsy 6, susceptibility to", "description": "" }, { "id": "MONDO:0013639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013639", "name": "NRCLP6", "description": "" }, { "id": "MONDO:0013639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013639", "name": "narcolepsy 6, susceptibility to", "description": "" }, { "id": "MONDO:0013639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013639", "name": "narcolepsy 6", "description": "" }, { "id": "MONDO:0008062", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008062", "name": "narcolepsy 1", "description": "A rare disorder characterized by sudden and transient episodes of loss of muscle tone. It often follows an experience of intense emotions. It is seen in patients with narcolepsy." }, { "id": "MONDO:0008062", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008062", "name": "HCRT narcolepsy", "description": "" }, { "id": "MONDO:0008062", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008062", "name": "narcolepsy 1", "description": "" }, { "id": "MONDO:0008062", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008062", "name": "narcolepsy caused by mutation in HCRT", "description": "" }, { "id": "MONDO:0008062", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008062", "name": "narcolepsy type 1", "description": "" }, { "id": "MONDO:0008062", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008062", "name": "NRCLP1", "description": "" }, { "id": "MONDO:0008062", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008062", "name": "cataplexy", "description": "" }, { "id": "MONDO:0008062", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008062", "name": "narcoleptic syndrome 1", "description": "" }, { "id": "MIM:614250", "resource": "MIM", "url": "https://www.omim.org/entry/614250", "name": "Narcolepsy 7", "description": "Narcolepsy 7" }, { "id": "MIM:161400", "resource": "MIM", "url": "https://www.omim.org/entry/161400", "name": "Narcolepsy 1", "description": "Narcolepsy 1" } ], "evidence": [ { "id": "8986", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8986" } ] }, { "disease_id": "DOID:9884", "recommended_name": { "id": "DOID:9884", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9884", "name": "muscular dystrophy", "description": "A myopathy is characterized by progressive skeletal muscle weakness degeneration." }, "synonyms": [ { "id": "MONDO:0010678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010678", "name": "muscular dystrophy, progressive Pectorodorsal", "description": "" }, { "id": "MONDO:0010678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010678", "name": "muscular dystrophy, progressive Pectorodorsal", "description": "" }, { "id": "MONDO:0010678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010678", "name": "muscular dystrophy, progressive, involving shoulder girdle and back", "description": "" }, { "id": "MONDO:0010884", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010884", "name": "muscular dystrophy, scapulohumeral", "description": "" }, { "id": "MONDO:0010884", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010884", "name": "muscular dystrophy, scapulohumeral", "description": "" }, { "id": "MONDO:0010676", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010676", "name": "muscular dystrophy, Hemizygous lethal type", "description": "" }, { "id": "MONDO:0010676", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010676", "name": "muscular dystrophy, Hemizygous lethal type", "description": "" }, { "id": "MONDO:0010675", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010675", "name": "muscular dystrophy, cardiac type", "description": "" }, { "id": "MONDO:0010675", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010675", "name": "muscular dystrophy, cardiac type", "description": "" }, { "id": "MONDO:0010677", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010677", "name": "muscular dystrophy, Mabry type", "description": "" }, { "id": "MONDO:0010677", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010677", "name": "muscular dystrophy, Mabry type", "description": "" }, { "id": "MONDO:0008028", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008028", "name": "muscular dystrophy, Barnes type", "description": "" }, { "id": "MONDO:0008028", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008028", "name": "muscular dystrophy, Barnes type", "description": "" }, { "id": "MONDO:0008034", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008034", "name": "muscular dystrophy, pseudohypertrophic, with Internalized capillaries", "description": "" }, { "id": "MONDO:0008034", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008034", "name": "muscular dystrophy, pseudohypertrophic, with Internalized capillaries", "description": "" } ], "evidence": [ { "id": "9884", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9884" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 30, "end_pos": 30, "sequence_org": "S", "sequence_mut": "A", "comment": "Decrease in activity and in phosphorylation by PKA. No phosphorylation by PKA, and strong decrease in activity; when associated with A-85.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "PubMed", "id": "12105205", "url": "https://glygen.org/publication/PubMed/12105205" } ] }, { "start_pos": 85, "end_pos": 85, "sequence_org": "S", "sequence_mut": "A", "comment": "No phosphorylation by PKA, and strong decrease in activity; when associated with A-30.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "PubMed", "id": "12105205", "url": "https://glygen.org/publication/PubMed/12105205" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "common_name": "Yeast" } ], "gene": [ { "name": "CKI1", "url": "https://www.uniprot.org/uniprot/P20485", "locus": {} } ], "crossref": [ { "id": "cd05157", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05157", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "850824", "url": "https://www.ncbi.nlm.nih.gov/gene/850824", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P20485", "url": "https://www.ebi.ac.uk/intact/interactors/id:P20485*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007521", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007521", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YLR133W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR133W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "P20485", "url": "https://oglcnac.org/atlas/detail/P20485", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P20485", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P20485", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CEQVINW", "url": "https://omabrowser.org/oma/group/CEQVINW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "144299at2759", "url": "http://www.orthodb.org/?query=144299at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22603", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22603", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22603:SF99", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22603:SF99", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01633", "url": "http://pfam.xfam.org/family/PF01633", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04428", "url": "http://pfam.xfam.org/family/PF04428", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P20485", "url": "http://purl.obolibrary.org/obo/PR_P20485", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013234", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013234", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004123", "url": "https://www.yeastgenome.org/locus/S000004123", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P20485-1", "url": "https://www.uniprot.org/uniprot/P20485-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVQESRPGSVRSYSVGYQARSRSSSQRRHSLTRQRSSQRLIRTISIESDVSNITDDDDLRAVNEGVAGVQLDVSETANKGPRRASATDVTDSLGSTSSEYIEIPFVKETLDASLPSDYLKQDILNLIQSLKISKWYNNKKIQPVAQDMNLVKISGAMTNAIFKVEYPKLPSLLLRIYGPNIDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFEQFLENSKTLTKDDIRNWKNSQRIARRMKELHVGVPLLSSERKNGSACWQKINQWLRTIEKVDQWVGDPKNIENSLLCENWSKFMDIVDRYHKWLISQEQGIEQVNKNLIFCHNDAQYGNLLFTAPVMNTPSLYTAPSSTSLTSQSSSLFPSSSNVIVDDIINPPKQEQSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYDYNNAKAPHQCHADRYPDKEQVLNFLYSYVSHLRGGAKEPIDEEVQRLYKSIIQWRPTVQLFWSLWAILQSGKLEKKEASTAITREEIGPNGKKYIIKTEPESPEEDFVENDDEPEAGVSIDTFDYMAYGRDKIAVFWGDLIGLGIITEEECKNFSSFKFLDTSYL", "length": 582, "header": "sp|P20485-1|KICH_YEAST Isoform 1 of Choline kinase OS=Saccharomyces cerevisiae S288C OX=559292 GN=CKI1 PE=1 SV=1 CANONICAL=P20485-1" }, "isoforms": [ { "isoform_ac": "P20485-1", "url": "", "sequence": { "sequence": "MVQESRPGSVRSYSVGYQARSRSSSQRRHSLTRQRSSQRLIRTISIESDVSNITDDDDLRAVNEGVAGVQLDVSETANKGPRRASATDVTDSLGSTSSEYIEIPFVKETLDASLPSDYLKQDILNLIQSLKISKWYNNKKIQPVAQDMNLVKISGAMTNAIFKVEYPKLPSLLLRIYGPNIDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFEQFLENSKTLTKDDIRNWKNSQRIARRMKELHVGVPLLSSERKNGSACWQKINQWLRTIEKVDQWVGDPKNIENSLLCENWSKFMDIVDRYHKWLISQEQGIEQVNKNLIFCHNDAQYGNLLFTAPVMNTPSLYTAPSSTSLTSQSSSLFPSSSNVIVDDIINPPKQEQSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYDYNNAKAPHQCHADRYPDKEQVLNFLYSYVSHLRGGAKEPIDEEVQRLYKSIIQWRPTVQLFWSLWAILQSGKLEKKEASTAITREEIGPNGKKYIIKTEPESPEEDFVENDDEPEAGVSIDTFDYMAYGRDKIAVFWGDLIGLGIITEEECKNFSSFKFLDTSYL", "length": 582, "header": "sp|P20485-1|KICH_YEAST Isoform 1 of Choline kinase OS=Saccharomyces cerevisiae S288C OX=559292 GN=CKI1 PE=1 SV=1 CANONICAL=P20485-1" }, "locus": { "chromosome": "XII", "start_pos": 410190, "end_pos": 408445, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YLR133W_mRNA", "url": "https://www.ensembl.org/id/YLR133W_mRNA" }, { "database": "Ensembl Peptide", "id": "YLR133W", "url": "https://www.ensembl.org/id/YLR133W" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 5, "start_aa": "Ser", "end_pos": 5, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser5", "evidence": [ { "id": "P20485", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P20485" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 9, "start_aa": "Ser", "end_pos": 9, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser9", "evidence": [ { "id": "P20485", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P20485" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P20485", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P20485" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] } ], "phosphorylation": [ { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser12" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser14" }, { "start_pos": 198, "end_pos": 198, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "15919656", "url": "https://glygen.org/publication/PubMed/15919656" } ], "site_lbl": "Ser198" }, { "start_pos": 236, "end_pos": 236, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "15919656", "url": "https://glygen.org/publication/PubMed/15919656" } ], "site_lbl": "Ser236" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "15919656", "url": "https://glygen.org/publication/PubMed/15919656" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" } ], "site_lbl": "Ser25" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "12105205", "url": "https://glygen.org/publication/PubMed/12105205" }, { "database": "PubMed", "id": "15919656", "url": "https://glygen.org/publication/PubMed/15919656" }, { "database": "PubMed", "id": "21078689", "url": "https://glygen.org/publication/PubMed/21078689" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" } ], "site_lbl": "Ser30" }, { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "15919656", "url": "https://glygen.org/publication/PubMed/15919656" } ], "site_lbl": "Ser37" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" } ], "site_lbl": "Ser45" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" } ], "site_lbl": "Ser48" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" } ], "site_lbl": "Ser51" }, { "start_pos": 54, "end_pos": 54, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" } ], "site_lbl": "Thr54" }, { "start_pos": 85, "end_pos": 85, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "12105205", "url": "https://glygen.org/publication/PubMed/12105205" }, { "database": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "21078689", "url": "https://glygen.org/publication/PubMed/21078689" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Ser85" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" } ], "site_lbl": "Thr90" }, { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ], "site_lbl": "Ser92" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" } ], "site_lbl": "Ser95" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Thr96" }, { "start_pos": 97, "end_pos": 97, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Ser97" }, { "start_pos": 98, "end_pos": 98, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P20485", "url": "https://www.yeastgenome.org/locus/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Ser98" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" }, { "database": "PubMed", "id": "15919656", "url": "https://glygen.org/publication/PubMed/15919656" } ], "site_lbl": "Ser9" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Isolation and characterization of the Saccharomyces cerevisiae EKI1 gene encoding ethanolamine kinase.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Kim K., Kim K.-H., Carman G.M., Voelker D.R., Storey M.K.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "10329685", "url": "https://glygen.org/publication/PubMed/10329685" } ] }, { "title": "Turnover of phosphatidylcholine in Saccharomyces cerevisiae. The role of the CDP-choline pathway.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Patton-Vogt J.L., Bier M.E., Dowd S.R.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "11078727", "url": "https://glygen.org/publication/PubMed/11078727" } ] }, { "title": "Phosphorylation of Saccharomyces cerevisiae choline kinase on Ser30 and Ser85 by protein kinase A regulates phosphatidylcholine synthesis by the CDP-choline pathway.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Yu Ying, Sreenivas Avula, Ostrander Darin B, Carman George M", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "12105205", "url": "https://glygen.org/publication/PubMed/12105205" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.", "journal": "Mol. Cell. Proteomics", "date": "2005", "authors": "Gruhler Albrecht, Olsen Jesper V, Mohammed Shabaz, Mortensen Peter, Faergeman Nils J, Mann Matthias, Jensen Ole N", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" } ] }, { "title": "Phosphorylation of the yeast choline kinase by protein kinase C. Identification of Ser25 and Ser30 as major sites of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2005-07-15", "authors": "Choi Mal-Gi, Kurnov Vladlen, Kersting Michael C, Sreenivas Avula, Carman George M", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "15919656", "url": "https://glygen.org/publication/PubMed/15919656" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "J. Proteome Res.", "date": "2007", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "Phosphorylation by casein kinase 2 regulates Nap1 localization and function.", "journal": "Mol. Cell. Biol.", "date": "2008", "authors": "Calvert Meredith E K, Keck Kristin M, Ptak Celeste, Shabanowitz Jeffrey, Hunt Donald F, Pemberton Lucy F", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "18086883", "url": "https://glygen.org/publication/PubMed/18086883" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Mol. Cell. Proteomics", "date": "2008", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Characterization of the rapamycin-sensitive phosphoproteome reveals that Sch9 is a central coordinator of protein synthesis.", "journal": "Genes & development", "date": "2009-08-15", "authors": "Huber Alexandre, Bodenmiller Bernd, Uotila Aino, Stahl Michael, Wanka Stefanie, Gerrits Bertran, Aebersold Ruedi, Loewith Robbie", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" }, { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "A global protein kinase and phosphatase interaction network in yeast.", "journal": "Science (New York, N.Y.)", "date": "2010-05-21", "authors": "Breitkreutz Ashton, Choi Hyungwon, Sharom Jeffrey R, Boucher Lorrie, Neduva Victor, Larsen Brett, Lin Zhen-Yuan, Breitkreutz Bobby-Joe, Stark Chris, Liu Guomin, Ahn Jessica, Dewar-Darch Danielle, Reguly Teresa, Tang Xiaojing, Almeida Ricardo, Qin Zhaohui Steve, Pawson Tony, Gingras Anne-Claude, Nesvizhskii Alexey I, Tyers Mike", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" } ] }, { "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.", "journal": "Molecular biology of the cell", "date": "2010-10-01", "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ] }, { "title": "Antagonistic interactions between the cAMP-dependent protein kinase and Tor signaling pathways modulate cell growth in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2011-02", "authors": "Ramachandran Vidhya, Herman Paul K", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "21078689", "url": "https://glygen.org/publication/PubMed/21078689" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P20485", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20485" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Cloning and characterization of the yeast CKI gene encoding choline kinase and its expression in Escherichia coli.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Yamashita S., Hosaka K., Kodaki T.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "2536698", "url": "https://glygen.org/publication/PubMed/2536698" } ] }, { "title": "Identification of novel O-GlcNAc transferase substrates using yeast cells expressing OGT.", "journal": "The Journal of general and applied microbiology", "date": "2021-04-16", "authors": "Li Feng, Yang Ganglong, Tachikawa Hiroyuki, Shao Kankai, Yang Yan, Gao Xiao-Dong, Nakanishi Hideki", "evidence": [ { "database": "O-GlcNAc Database", "id": "P20485", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P20485" }, { "database": "O-GlcNAc Atlas", "id": "P20485", "url": "https://oglcnac.org/atlas/detail/P20485" } ], "reference": [ { "type": "PubMed", "id": "33229814", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] }, { "title": "Expression, purification, and characterization of choline kinase, product of the CKI gene from Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Kim K.H., Carman G.M., Voelker D.R., Flocco M.T.", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "reference": [ { "type": "PubMed", "id": "9506987", "url": "https://glygen.org/publication/PubMed/9506987" } ] } ], "pathway": [ { "id": "sce:YLR133W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR133W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "pmid": "" }, { "name": "choline kinase activity", "id": "GO:0004103", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004103", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "pmid": "" }, { "name": "ethanolamine kinase activity", "id": "GO:0004305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004305", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "phosphatidylcholine biosynthetic process", "id": "GO:0006656", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006656", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "pmid": "" }, { "name": "phosphatidylethanolamine biosynthetic process", "id": "GO:0006646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006646", "evidence": [ { "database": "UniProtKB", "id": "P20485", "url": "https://www.uniprot.org/uniprot/P20485" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 259, "end_pos": 261, "annotation": "n_glycosylation_sequon" }, { "start_pos": 295, "end_pos": 297, "annotation": "n_glycosylation_sequon" }, { "start_pos": 52, "end_pos": 54, "annotation": "n_glycosylation_sequon" }, { "start_pos": 570, "end_pos": 572, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12837", "name": "", "equation": "ATP + choline = ADP + H(+) + phosphocholine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O54783-1", "Q01134-1", "Q9Y259-1", "P35790-1", "O54804-1", "O55229-1", "P20485-1", "Q03764-1" ], "evidence": [ { "id": "12837", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12837" } ] }, { "id": "13069", "name": "", "equation": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O54783-1", "D3ZRW8-1", "Q01134-1", "Q9Y259-1", "P35790-1", "Q9NVF9-1", "Q9HBU6-1", "O54804-1", "O55229-1", "A7MCT6-1", "Q9D4V0-1", "P20485-1", "Q03764-1", "Q554D8-1", "Q869T9-1", "P54352-1" ], "evidence": [ { "id": "13069", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/13069" } ] }, { "id": "R-SCE-1483004", "name": "Cho is phosphorylated to PCho by CHK dimer", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-1524071" ], "enzyme_list": [ "Q03764-1", "P20485-1" ], "evidence": [ { "id": "R-SCE-1483004", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-1483004" } ] }, { "id": "R-SCE-1483222", "name": "ETA is phosphorylated to PETA by CHK/ETNK", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-1498751" ], "output_participant_list": [ "R-ALL-428686" ], "enzyme_list": [ "Q03764-1", "P20485-1" ], "evidence": [ { "id": "R-SCE-1483222", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-1483222" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1498751", "participant_name": "ETA [cytosol]", "crossref": [ { "id": "16000", "database": "ChEBI", "url": "" }, { "id": "HMDB0000149", "database": "HMDB Metabolite", "url": "" }, { "id": "000008214617", "database": "ZINC", "url": "" }, { "id": "C00189", "database": "COMPOUND", "url": "" }, { "id": "16000", "database": "ChEBI", "url": "" }, { "id": "HMDB0000149", "database": "HMDB Metabolite", "url": "" }, { "id": "000008214617", "database": "ZINC", "url": "" }, { "id": "C00189", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000149", "database": "HMDB Metabolite", "url": "" }, { "id": "C00189", "database": "COMPOUND", "url": "" }, { "id": "16000", "database": "ChEBI", "url": "" }, { "id": "000008214617", "database": "ZINC", "url": "" }, { "id": "16000", "database": "ChEBI", "url": "" }, { "id": "HMDB0000149", "database": "HMDB Metabolite", "url": "" }, { "id": "000008214617", "database": "ZINC", "url": "" }, { "id": "C00189", "database": "COMPOUND", "url": "" }, { "id": "16000", "database": "ChEBI", "url": "" }, { "id": "HMDB0000149", "database": "HMDB Metabolite", "url": "" }, { "id": "000008214617", "database": "ZINC", "url": "" }, { "id": "C00189", "database": "COMPOUND", "url": "" }, { "id": "16000", "database": "ChEBI", "url": "" }, { "id": "HMDB0000149", "database": "HMDB Metabolite", "url": "" }, { "id": "000008214617", "database": "ZINC", "url": "" }, { "id": "C00189", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-1524071", "participant_name": "PCho [cytosol]", "crossref": [ { "id": "36700", "database": "ChEBI", "url": "" }, { "id": "36700", "database": "ChEBI", "url": "" }, { "id": "36700", "database": "ChEBI", "url": "" }, { "id": "36700", "database": "ChEBI", "url": "" }, { "id": "36700", "database": "ChEBI", "url": "" }, { "id": "36700", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-428686", "participant_name": "PETA [cytosol]", "crossref": [ { "id": "17553", "database": "ChEBI", "url": "" }, { "id": "C00346", "database": "COMPOUND", "url": "" }, { "id": "000003870166", "database": "ZINC", "url": "" }, { "id": "HMDB0000224", "database": "HMDB Metabolite", "url": "" }, { "id": "17553", "database": "ChEBI", "url": "" }, { "id": "C00346", "database": "COMPOUND", "url": "" }, { "id": "000003870166", "database": "ZINC", "url": "" }, { "id": "HMDB0000224", "database": "HMDB Metabolite", "url": "" }, { "id": "17553", "database": "ChEBI", "url": "" }, { "id": "C00346", "database": "COMPOUND", "url": "" }, { "id": "000003870166", "database": "ZINC", "url": "" }, { "id": "HMDB0000224", "database": "HMDB Metabolite", "url": "" }, { "id": "17553", "database": "ChEBI", "url": "" }, { "id": "C00346", "database": "COMPOUND", "url": "" }, { "id": "000003870166", "database": "ZINC", "url": "" }, { "id": "HMDB0000224", "database": "HMDB Metabolite", "url": "" }, { "id": "17553", "database": "ChEBI", "url": "" }, { "id": "C00346", "database": "COMPOUND", "url": "" }, { "id": "000003870166", "database": "ZINC", "url": "" }, { "id": "HMDB0000224", "database": "HMDB Metabolite", "url": "" }, { "id": "17553", "database": "ChEBI", "url": "" }, { "id": "C00346", "database": "COMPOUND", "url": "" }, { "id": "000003870166", "database": "ZINC", "url": "" }, { "id": "HMDB0000224", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A7MCT6", "gene_name": "Etnk2", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "A7MCT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A7MCT6" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "A7MCT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A7MCT6" } ] } ] }, { "uniprot_ac": "D3ZRW8", "gene_name": "Etnk2", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "D3ZRW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRW8" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "D3ZRW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRW8" } ] } ] }, { "uniprot_ac": "O54783", "gene_name": "Chkb", "activity": [ { "ec_number": "2.7.1.32", "activity": "ATP + choline = ADP + H(+) + phosphocholine.", "evidence": [ { "id": "O54783", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54783" } ] }, { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "O54783", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54783" } ] } ] }, { "uniprot_ac": "O54804", "gene_name": "Chka", "activity": [ { "ec_number": "2.7.1.32", "activity": "ATP + choline = ADP + H(+) + phosphocholine.", "evidence": [ { "id": "O54804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54804" } ] }, { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "O54804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54804" } ] }, { "ec_number": "2.7.1.32", "activity": "", "evidence": [ { "id": "O54804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54804" } ] } ] }, { "uniprot_ac": "O55229", "gene_name": "Chkb", "activity": [ { "ec_number": "2.7.1.32", "activity": "ATP + choline = ADP + H(+) + phosphocholine.", "evidence": [ { "id": "O55229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55229" } ] }, { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "O55229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55229" } ] } ] }, { "uniprot_ac": "P20485", "gene_name": "CKI1", "activity": [ { "ec_number": "2.7.1.32", "activity": "ATP + choline = ADP + H(+) + phosphocholine.", "evidence": [ { "id": "P20485", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20485" } ] }, { "ec_number": "2.7.1.32", "activity": "", "evidence": [ { "id": "P20485", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20485" } ] } ] }, { "uniprot_ac": "P35790", "gene_name": "CHKA", "activity": [ { "ec_number": "2.7.1.32", "activity": "ATP + choline = ADP + H(+) + phosphocholine.", "evidence": [ { "id": "P35790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35790" } ] }, { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "P35790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35790" } ] }, { "ec_number": "2.7.1.32", "activity": "", "evidence": [ { "id": "P35790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35790" } ] } ] }, { "uniprot_ac": "P54352", "gene_name": "eas", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "P54352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54352" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "P54352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54352" } ] }, { "ec_number": "2.7.1.32", "activity": "ATP + choline = ADP + H(+) + phosphocholine.", "evidence": [ { "id": "P54352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54352" } ] } ] }, { "uniprot_ac": "Q01134", "gene_name": "Chka", "activity": [ { "ec_number": "2.7.1.32", "activity": "ATP + choline = ADP + H(+) + phosphocholine.", "evidence": [ { "id": "Q01134", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01134" } ] }, { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "Q01134", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01134" } ] }, { "ec_number": "2.7.1.32", "activity": "", "evidence": [ { "id": "Q01134", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01134" } ] } ] }, { "uniprot_ac": "Q03764", "gene_name": "EKI1", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "Q03764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03764" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "Q03764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03764" } ] } ] }, { "uniprot_ac": "Q554D8", "gene_name": "etnkB", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "Q554D8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q554D8" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "Q554D8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q554D8" } ] } ] }, { "uniprot_ac": "Q869T9", "gene_name": "etnkA", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "Q869T9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869T9" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "Q869T9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869T9" } ] } ] }, { "uniprot_ac": "Q9D4V0", "gene_name": "Etnk1", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "Q9D4V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4V0" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "Q9D4V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4V0" } ] } ] }, { "uniprot_ac": "Q9HBU6", "gene_name": "ETNK1", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "Q9HBU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBU6" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "Q9HBU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBU6" } ] } ] }, { "uniprot_ac": "Q9NVF9", "gene_name": "ETNK2", "activity": [ { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "Q9NVF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVF9" } ] }, { "ec_number": "2.7.1.82", "activity": "", "evidence": [ { "id": "Q9NVF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVF9" } ] } ] }, { "uniprot_ac": "Q9Y259", "gene_name": "CHKB", "activity": [ { "ec_number": "2.7.1.32", "activity": "ATP + choline = ADP + H(+) + phosphocholine.", "evidence": [ { "id": "Q9Y259", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y259" } ] }, { "ec_number": "2.7.1.82", "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.", "evidence": [ { "id": "Q9Y259", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y259" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 19 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }