{ "uniprot_canonical_ac": "P20009-1", "uniprot_ac": "P20009", "uniprot_id": "DLL_DROME", "mass": { "chemical_mass": 35262.0, "monoisotopic_mass": 35262.0 }, "refseq": { "ac": "NP_523857", "name": "Distal-less, isoform A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523857" }, "gene_names": [ { "name": "Dll", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "2.7; Art; Ba; BcDNA:LP01770; CG3629; dll; DLL; Dmel\\CG3629; E(Arp); En(Arp); l(2)01092; l(2)387", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523857", "id": "NP_523857" }, { "name": "2.7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "Art", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "BR", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "Ba", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "BcDNA:LP01770", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "CG3629", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "DLL", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "Dll", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523857", "id": "NP_523857" }, { "name": "Dmel\\CG3629", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "Dmel_CG3629", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "E(Arp)", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "En(Arp)", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "dll", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "l(2)01092", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" }, { "name": "l(2)387", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P20009", "id": "P20009" } ], "protein_names": [ { "name": "Homeotic protein distal-less", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P20009" }, { "name": "CG3629-PA; Dll-PA; distalless; distal-less; distallless; Distall-less; brista; enhancer of Arp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523857", "id": "NP_523857" }, { "name": "CG3629-PC; Dll-PC; distalless; distal-less; distallless; Distall-less; brista; enhancer of Arp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001137759", "id": "NP_001137759" }, { "name": "Distal-less, isoform A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523857", "id": "NP_523857" }, { "name": "Distal-less, isoform C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001137759", "id": "NP_001137759" }, { "name": "Protein brista", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P20009" } ], "function": [ { "annotation": "Transcription factor that plays a role in larval and adult appendage development. Specifies the identity of ventral appendages (including legs and antennae) and suppresses dorsal appendage development. Involved in patterning the distal-proximal limb axis. May control the adhesive properties of cells during limb morphogenesis. Also has a secondary role in the normal patterning of the wing margin.", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009#function" }, { "database": "PubMed", "id": "9303541", "url": "https://glygen.org/publication/PubMed/9303541" }, { "database": "PubMed", "id": "1358457", "url": "https://glygen.org/publication/PubMed/1358457" }, { "database": "PubMed", "id": "9778507", "url": "https://glygen.org/publication/PubMed/9778507" }, { "database": "PubMed", "id": "2564639", "url": "https://glygen.org/publication/PubMed/2564639" } ] } ], "disease": [ { "disease_id": "DOID:0080408", "recommended_name": { "id": "DOID:0080408", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080408", "name": "orofacial cleft 15", "description": "An orofacial cleft that has_material_basis_in mutation in the DLX4 gene on chromosome 17q21." }, "synonyms": [ { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "orofacial cleft 15", "description": "Any cleft lip/palate in which the cause of the disease is a mutation in the DLX4 gene." }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "DLX4 cleft lip/palate", "description": "" }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "OFC15", "description": "" }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "cleft lip/palate caused by mutation in DLX4", "description": "" }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "orofacial cleft 15", "description": "" }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "orofacial cleft type 15", "description": "" }, { "id": "MIM:616788", "resource": "MIM", "url": "https://www.omim.org/entry/616788", "name": "Non-syndromic orofacial cleft 15", "description": "Non-syndromic orofacial cleft 15" } ], "evidence": [ { "id": "0080408", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080408" } ] }, { "disease_id": "DOID:0090021", "recommended_name": { "id": "DOID:0090021", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090021", "name": "split hand-foot malformation 1", "description": "A split-hand/foot malformation that has_material_basis_in contiguous gene mutations caused by deletion, duplication, or rearrangement of chromosome 7q21.3 involving the DSS1, DLX5, and DLX6 genes and possible regulatory elements in the region." }, "synonyms": [ { "id": "DOID:0090021", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090021", "name": "SHFD1", "description": "" }, { "id": "DOID:0090021", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090021", "name": "SHFM1", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "split hand-foot malformation 1", "description": "Split-hand/foot malformation mapped to chromosome 7q21.3" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "SHFD1", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "SHFM1", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "split hand-foot malformation type 1", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "split hand/foot malformation 1", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "split-hand/foot malformation type 1", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "ectrodactyly", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "split-hand deformity", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "split-hand/foot deformity 1", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "split-hand/foot malformation 1", "description": "" }, { "id": "MONDO:0008464", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008464", "name": "split-hand/foot malformation 1 with or without deafness", "description": "" } ], "evidence": [ { "id": "0090021", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0090021" } ] }, { "disease_id": "DOID:0090024", "recommended_name": { "id": "DOID:0090024", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090024", "name": "split hand-foot malformation 1 with sensorineural hearing loss", "description": "A split-hand/foot malformation characterized by split-hand/foot malformation and sensorineural hearing impairment that has_material_basis_in homozygous mutation in the DLX5 gene on chromosome 7q21." }, "synonyms": [ { "id": "DOID:0090024", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090024", "name": "SHFM1D", "description": "" }, { "id": "DOID:0090024", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090024", "name": "congenital deafness with split hands and feet", "description": "" }, { "id": "MONDO:0009080", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009080", "name": "split hand-foot malformation 1 with sensorineural hearing loss", "description": "Split hand - split foot - deafness is an extremely rare genetic syndrome reported in a few families to date and characterized clinically by split hand/split foot malformation (SHFM) and mild to moderate sensorineural hearing loss, sometimes associated with cleft palate and intellectual deficit." }, { "id": "MONDO:0009080", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009080", "name": "SHFM1D", "description": "" }, { "id": "MONDO:0009080", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009080", "name": "congenital deafness with split hands and feet", "description": "" }, { "id": "MONDO:0009080", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009080", "name": "split hand-foot malformation 1 with sensorineural hearing loss", "description": "" }, { "id": "MONDO:0009080", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009080", "name": "split-hand/foot malformation 1 with sensorineural hearing loss", "description": "" }, { "id": "MONDO:0009080", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009080", "name": "deafness, congenital, with split hands and feet", "description": "" }, { "id": "MONDO:0009080", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009080", "name": "split hand-split foot-deafness syndrome", "description": "" }, { "id": "MONDO:0009080", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009080", "name": "split-hand/foot malformation 1 with sensorineural hearing loss, autosomal recessive", "description": "" }, { "id": "MIM:220600", "resource": "MIM", "url": "https://www.omim.org/entry/220600", "name": "Split-hand/foot malformation 1 with sensorineural hearing loss, autosomal recessive", "description": "Split-hand/foot malformation 1 with sensorineural hearing loss, autosomal recessive" } ], "evidence": [ { "id": "0090024", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0090024" } ] }, { "disease_id": "DOID:0110053", "recommended_name": { "id": "DOID:0110053", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110053", "name": "amelogenesis imperfecta type 4", "description": "An amelogenesis imperfecta which can has_material_basis_in mutation in the DLX3 gene." }, "synonyms": [ { "id": "DOID:0110053", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110053", "name": "AI4", "description": "" }, { "id": "DOID:0110053", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110053", "name": "AIHHT", "description": "" }, { "id": "DOID:0110053", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110053", "name": "amelogenesis imperfecta hypomaturation-hypoplastic type with taurodontism", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "hypomaturation-hypoplastic amelogenesis imperfecta with taurodontism", "description": "Any amelogenesis imperfecta in which the cause of the disease is a mutation in the DLX3 gene." }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "AI4", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "AIHHT", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "DLX3 amelogenesis imperfecta", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "amelogenesis imperfecta caused by mutation in DLX3", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "amelogenesis imperfecta hypomaturation-hypoplastic type with taurodontism", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "amelogenesis imperfecta type 4", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "amelogenesis imperfecta, hypomaturation-hypoplastic type, with taurodontism", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "amelogenesis imperfecta, type 4", "description": "" }, { "id": "MONDO:0007093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007093", "name": "amelogenesis imperfecta, type IV", "description": "" }, { "id": "MIM:104510", "resource": "MIM", "url": "https://www.omim.org/entry/104510", "name": "Amelogenesis imperfecta 4", "description": "Amelogenesis imperfecta 4" } ], "evidence": [ { "id": "0110053", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110053" } ] }, { "disease_id": "DOID:0111565", "recommended_name": { "id": "DOID:0111565", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111565", "name": "trichodontoosseous syndrome", "description": "A syndrome characterized by curly kinky hair at birth, enamel hypoplasia, taurodontism, thickening of cortical bones and variable expression of craniofacial morphology that has_material_basis_in heterozygous mutation in the DLX3 gene on chromosome 17q21.33." }, "synonyms": [ { "id": "DOID:0111565", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111565", "name": "TDO syndrome", "description": "" }, { "id": "DOID:0111565", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111565", "name": "tricho-dento-osseous syndrome", "description": "" }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "tricho-dento-osseous syndrome", "description": "Tricho-dento-osseous dysplasia (TDO) belongs to the ectodermal dysplasias and is characterized by curly/kinky hair at birth, enamel hypoplasia with discolouration and molar taurodontism, increased overall bone mineral density (BMD) and increased thickness of the cortical bones of the skull." }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "TDO syndrome", "description": "" }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "trichodontoosseous syndrome", "description": "" }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "TDO", "description": "" }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "TDO syndrome 1", "description": "" }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "TRICHODENTOOSSEOUS syndrome", "description": "" }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "Tricho-dento-osseous syndrome 1", "description": "" }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "enamel hypoplasia and hypocalcification with associated strikingly curly hair", "description": "" }, { "id": "MONDO:0008592", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008592", "name": "kinky or curly hair, dolichocephaly, enamel hypoplasia, increased dental caries, radial dense bones, and brittle nails", "description": "" }, { "id": "MIM:190320", "resource": "MIM", "url": "https://www.omim.org/entry/190320", "name": "Trichodentoosseous syndrome", "description": "Trichodentoosseous syndrome" } ], "evidence": [ { "id": "0111565", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111565" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Dll", "url": "https://www.uniprot.org/uniprot/P20009", "locus": { "chromosome": "2R", "start_pos": 24835667, "end_pos": 24814822, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0000157", "url": "https://www.ensembl.org/id/FBgn0000157" } ] } } ], "crossref": [ { "id": "FBgn0000157", "url": "https://bgee.org/?page=gene&gene_id=FBgn0000157", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0000157", "url": "https://flybase.org/reports/FBgn0000157", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "37973", "url": "https://www.ncbi.nlm.nih.gov/gene/37973", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "A2VEF7", "url": "https://www.ebi.ac.uk/intact/interactors/id:A2VEF7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P20009", "url": "https://www.ebi.ac.uk/intact/interactors/id:P20009*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000047", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020479", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020479", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG3629", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG3629", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YQHFAPQ", "url": "https://omabrowser.org/oma/group/YQHFAPQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2969529at2759", "url": "http://www.orthodb.org/?query=2969529at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24327", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24327", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24327:SF81", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24327:SF81", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "http://pfam.xfam.org/family/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P20009", "url": "http://purl.obolibrary.org/obo/PR_P20009", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_523857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523857", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2VEF7-1", "url": "https://www.uniprot.org/uniprot/A2VEF7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P20009-1", "url": "https://www.uniprot.org/uniprot/P20009-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P20009-2", "url": "https://www.uniprot.org/uniprot/P20009-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPPPQMGGYVPQYWYQPETNPSLVTVWPAV", "length": 327, "header": "sp|P20009-1|DLL_DROME Isoform 1 of Homeotic protein distal-less OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=3 CANONICAL=P20009-1" }, "isoforms": [ { "isoform_ac": "A2VEF7-1", "url": "", "sequence": { "sequence": "MDAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPPPQMGGYVPQYWYQPETNPSLVT", "length": 347, "header": "tr|A2VEF7-1|A2VEF7_DROME Computationally mapped isoform of Distal-less, isoform C OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=1 CANONICAL=P20009-1" }, "locus": { "chromosome": "2R", "start_pos": 24834014, "end_pos": 24815437, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0300076", "url": "https://www.ensembl.org/id/FBtr0300076" }, { "database": "Ensembl Peptide", "id": "FBpp0289353", "url": "https://www.ensembl.org/id/FBpp0289353" } ] } }, { "isoform_ac": "P20009-1", "url": "", "sequence": { "sequence": "MDAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPPPQMGGYVPQYWYQPETNPSLVTVWPAV", "length": 327, "header": "sp|P20009-1|DLL_DROME Isoform 1 of Homeotic protein distal-less OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=3 CANONICAL=P20009-1" }, "locus": { "chromosome": "2R", "start_pos": 24834169, "end_pos": 24815437, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0072379", "url": "https://www.ensembl.org/id/FBtr0072379" }, { "database": "Ensembl Peptide", "id": "FBpp0072286", "url": "https://www.ensembl.org/id/FBpp0072286" } ] } }, { "isoform_ac": "P20009-2", "url": "", "sequence": { "sequence": "MDAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPPPQMGGYVPQYWYQPETNPSLVT", "length": 322, "header": "sp|P20009-2|DLL_DROME Isoform 2 of Homeotic protein distal-less OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=3 CANONICAL=P20009-1" }, "locus": { "chromosome": "2R", "start_pos": 24834014, "end_pos": 24815437, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0072378", "url": "https://www.ensembl.org/id/FBtr0072378" }, { "database": "Ensembl Peptide", "id": "FBpp0072285", "url": "https://www.ensembl.org/id/FBpp0072285" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" }, { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" }, { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Homeotic genes of the Bithorax complex repress limb development in the abdomen of the Drosophila embryo through the target gene Distal-less.", "journal": "Cell", "date": "1992", "authors": "Cohen B., Botas J., Cohen S.M., Pfeifle C., McGuffin M.E., Vachon G.", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "reference": [ { "type": "PubMed", "id": "1358457", "url": "https://glygen.org/publication/PubMed/1358457" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Distal-less encodes a homoeodomain protein required for limb development in Drosophila.", "journal": "Nature", "date": "1989", "authors": "Cohen S.M., Jaeckle H., Broenner G., Juergens G., Kuettner F.", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "reference": [ { "type": "PubMed", "id": "2564639", "url": "https://glygen.org/publication/PubMed/2564639" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A2VEF7", "url": "https://www.uniprot.org/uniprot/A2VEF7" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] }, { "title": "The homeobox gene Distal-less induces ventral appendage development in Drosophila.", "journal": "Genes Dev.", "date": "1997", "authors": "Guerrero I., Gorfinkiel N., Morata G.", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "reference": [ { "type": "PubMed", "id": "9303541", "url": "https://glygen.org/publication/PubMed/9303541" } ] }, { "title": "The roles of the homeobox genes aristaless and Distal-less in patterning the legs and wings of Drosophila.", "journal": "Development", "date": "1998", "authors": "Campbell G., Tomlinson A.", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "reference": [ { "type": "PubMed", "id": "9778507", "url": "https://glygen.org/publication/PubMed/9778507" } ] } ], "pathway": [ { "id": "dme:Dmel_CG3629", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG3629", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 17, "go_terms": [ { "name": "specification of animal organ identity", "id": "GO:0010092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010092", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "determination of ventral identity", "id": "GO:0048264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048264", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "antennal development", "id": "GO:0007469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007469", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "proboscis development", "id": "GO:0048728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048728", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "leg disc proximal/distal pattern formation", "id": "GO:0007479", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007479", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "imaginal disc-derived leg morphogenesis", "id": "GO:0007480", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007480", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "imaginal disc-derived male genitalia development", "id": "GO:0007485", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007485", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "analia development", "id": "GO:0007487", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007487", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "imaginal disc-derived wing margin morphogenesis", "id": "GO:0008587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008587", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "mushroom body development", "id": "GO:0016319", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016319", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "genital disc development", "id": "GO:0035215", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035215", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "imaginal disc-derived appendage morphogenesis", "id": "GO:0035114", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035114", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "proximal/distal pattern formation, imaginal disc", "id": "GO:0007449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007449", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "animal organ development", "id": "GO:0048513", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048513", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P20009", "url": "https://www.uniprot.org/uniprot/P20009" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }