{ "uniprot_canonical_ac": "P17898-1", "uniprot_ac": "P17898", "uniprot_id": "CPT1_YEAST", "mass": { "chemical_mass": 44829.0, "monoisotopic_mass": 44829.0 }, "refseq": { "ac": "NP_014269", "name": "diacylglycerol cholinephosphotransferase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014269" }, "gene_names": [ { "name": "CPT1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P17898", "id": "P17898" }, { "name": "CPT1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014269", "id": "NP_014269" }, { "name": "N1218", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P17898", "id": "P17898" }, { "name": "N1867", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P17898", "id": "P17898" } ], "protein_names": [ { "name": "Cholinephosphotransferase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P17898" }, { "name": "2.7.8.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17898" }, { "name": "Aminoalcohol phosphotransferase CPT1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17898" }, { "name": "CHOPT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17898" }, { "name": "Diacylglycerol cholinephosphotransferase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17898" }, { "name": "Sn-1,2-diacylglycerol cholinephosphotransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17898" }, { "name": "diacylglycerol cholinephosphotransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014269", "id": "NP_014269" } ], "function": [ { "annotation": "Catalyzes the final step in the CDP-choline route leading to phosphatidylcholin (PC). Preferentially uses CDP-monomethylethanolamine as aminoalcohol substrate. Shows highest activity toward di- and mono-unsaturated diacylglycerol species as lipid substrates. The CDP-choline pathway only contributes to net PC synthesis if exogenous choline is present. In its absence, this pathway recycles choline from PC turnover and may contribute to maintaining the proper PC species composition.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898#function" }, { "database": "PubMed", "id": "7961735", "url": "https://glygen.org/publication/PubMed/7961735" }, { "database": "PubMed", "id": "7961445", "url": "https://glygen.org/publication/PubMed/7961445" }, { "database": "PubMed", "id": "15225629", "url": "https://glygen.org/publication/PubMed/15225629" }, { "database": "PubMed", "id": "3029130", "url": "https://glygen.org/publication/PubMed/3029130" }, { "database": "PubMed", "id": "1847919", "url": "https://glygen.org/publication/PubMed/1847919" } ] } ], "disease": [ { "disease_id": "DOID:0112349", "recommended_name": { "id": "DOID:0112349", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112349", "name": "hereditary spastic paraplegia 81", "description": "A hereditary spastic paraplegia characterized by onset in infancy, delayed motor development, progressive spasticity, and other neurologic impairments that has_material_basis_in homozygous or compound heterozygous mutation in the SELENOI gene on chromosome 2p23.3." }, "synonyms": [ { "id": "DOID:0112349", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112349", "name": "SPG81", "description": "" }, { "id": "DOID:0112349", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112349", "name": "autosomal recessive complex SPG due to Kennedy pathway dysfunction", "description": "" }, { "id": "DOID:0112349", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112349", "name": "spastic paraplegia 81 autosomal recessive", "description": "" }, { "id": "DOID:0112349", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112349", "name": "autosomal recessive complex spastic paraplegia due to Kennedy pathway dysfunction", "description": "" }, { "id": "MONDO:0032905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032905", "name": "spastic paraplegia 81, autosomal recessive", "description": "" }, { "id": "MONDO:0032905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032905", "name": "SPASTIC PARAPLEGIA 81, AUTOSOMAL RECESSIVE", "description": "" }, { "id": "MONDO:0032905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032905", "name": "SPG81", "description": "" }, { "id": "MIM:618768", "resource": "MIM", "url": "https://www.omim.org/entry/618768", "name": "Spastic paraplegia 81, autosomal recessive", "description": "Spastic paraplegia 81, autosomal recessive" } ], "evidence": [ { "id": "0112349", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0112349" } ] }, { "disease_id": "DOID:5679", "recommended_name": { "id": "DOID:5679", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5679", "name": "retinal disease", "description": "An eye disease that is located_in the retina." }, "synonyms": [], "evidence": [ { "id": "5679", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5679" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "common_name": "Yeast" } ], "gene": [ { "name": "CPT1", "url": "https://www.uniprot.org/uniprot/P17898", "locus": {} } ], "crossref": [ { "id": "2.7.8.2", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.8.2&UniProtAcc=P17898", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "855593", "url": "https://www.ncbi.nlm.nih.gov/gene/855593", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P17898", "url": "https://www.ebi.ac.uk/intact/interactors/id:P17898*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000462", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000462", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014472", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014472", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043130", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043130", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNL130C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL130C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "EFCGPVE", "url": "https://omabrowser.org/oma/group/EFCGPVE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5482983at2759", "url": "http://www.orthodb.org/?query=5482983at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10414", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10414", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10414:SF66", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10414:SF66", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01066", "url": "http://pfam.xfam.org/family/PF01066", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P17898", "url": "http://purl.obolibrary.org/obo/PR_P17898", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014269", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014269", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005074", "url": "https://www.yeastgenome.org/locus/S000005074", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P17898-1", "url": "https://www.uniprot.org/uniprot/P17898-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGFFIPQSSLGNLKLYKYQSDDRSFLSNHVLRPFWRKFATIFPLWMAPNLVTLLGFCFIIFNVLTTLYYDPYFDQESPRWTYFSYAIGLFLYQTFDACDGMHARRTGQQGPLGELFDHCIDSINTTLSMIPVCSMTGMGYTYMTIFSQFAILCSFYLSTWEEYHTHKLYLAEFCGPVEGIIVLCISFIAVGIYGPQTIWHTKVAQFSWQDFVFDVETVHLMYAFCTGALIFNIVTAHTNVVRYYESQSTKSATPSKTAENISKAVNGLLPFFAYFSSIFTLVLIQPSFISLALILSIGFSVAFVVGRMIIAHLTMQPFPMVNFPFLIPTIQLVLYAFMVYVLDYQKGSIVSALVWMGLGLTLAIHGMFINDIIYDITTFLDIYALSIKHPKEI", "length": 393, "header": "sp|P17898-1|CPT1_YEAST Isoform 1 of Cholinephosphotransferase 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=CPT1 PE=1 SV=3 CANONICAL=P17898-1" }, "isoforms": [ { "isoform_ac": "P17898-1", "url": "", "sequence": { "sequence": "MGFFIPQSSLGNLKLYKYQSDDRSFLSNHVLRPFWRKFATIFPLWMAPNLVTLLGFCFIIFNVLTTLYYDPYFDQESPRWTYFSYAIGLFLYQTFDACDGMHARRTGQQGPLGELFDHCIDSINTTLSMIPVCSMTGMGYTYMTIFSQFAILCSFYLSTWEEYHTHKLYLAEFCGPVEGIIVLCISFIAVGIYGPQTIWHTKVAQFSWQDFVFDVETVHLMYAFCTGALIFNIVTAHTNVVRYYESQSTKSATPSKTAENISKAVNGLLPFFAYFSSIFTLVLIQPSFISLALILSIGFSVAFVVGRMIIAHLTMQPFPMVNFPFLIPTIQLVLYAFMVYVLDYQKGSIVSALVWMGLGLTLAIHGMFINDIIYDITTFLDIYALSIKHPKEI", "length": 393, "header": "sp|P17898-1|CPT1_YEAST Isoform 1 of Cholinephosphotransferase 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=CPT1 PE=1 SV=3 CANONICAL=P17898-1" }, "locus": { "chromosome": "XIV", "start_pos": 380831, "end_pos": 379561, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YNL130C_mRNA", "url": "https://www.ensembl.org/id/YNL130C_mRNA" }, { "database": "Ensembl Peptide", "id": "YNL130C", "url": "https://www.ensembl.org/id/YNL130C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17898", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17898" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ], "site_lbl": "Ser9" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii.", "journal": "Genome Biol.", "date": "2003", "authors": "Zhang Z., Philippsen P., Stuart L., Dietrich F.S., Brachat S., Gaffney T.D., Gates K., Lerch A., Voegeli S.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "12844361", "url": "https://glygen.org/publication/PubMed/12844361" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The selective utilization of substrates in vivo by the phosphatidylethanolamine and phosphatidylcholine biosynthetic enzymes Ept1p and Cpt1p in yeast.", "journal": "FEBS Lett.", "date": "2004", "authors": "Heck A.J., Boumann H.A., de Kroon A.I., de Kruijff B.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "15225629", "url": "https://glygen.org/publication/PubMed/15225629" } ] }, { "title": "sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases in Saccharomyces cerevisiae. Mixed micellar analysis of the CPT1 and EPT1 gene products.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Bell R.M., Hjelmstad R.H.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "1847919", "url": "https://glygen.org/publication/PubMed/1847919" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P17898", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17898" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P17898", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17898" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "The sn-1,2-diacylglycerol cholinephosphotransferase of Saccharomyces cerevisiae. Nucleotide sequence, transcriptional mapping, and gene product analysis of the CPT1 gene.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Bell R.M., Hjelmstad R.H.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "2153142", "url": "https://glygen.org/publication/PubMed/2153142" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Subcellular and submitochondrial localization of phospholipid-synthesizing enzymes in Saccharomyces cerevisiae.", "journal": "J. Bacteriol.", "date": "1986", "authors": "Kuchler K., Daum G., Paltauf F.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "3005242", "url": "https://glygen.org/publication/PubMed/3005242" } ] }, { "title": "Mutants of Saccharomyces cerevisiae defective in sn-1,2-diacylglycerol cholinephosphotransferase. Isolation, characterization, and cloning of the CPT1 gene.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Bell R.M., Hjelmstad R.H.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "3029130", "url": "https://glygen.org/publication/PubMed/3029130" } ] }, { "title": "Functional redundancy of CDP-ethanolamine and CDP-choline pathway enzymes in phospholipid biosynthesis: ethanolamine-dependent effects on steady-state membrane phospholipid composition in Saccharomyces cerevisiae.", "journal": "J. Bacteriol.", "date": "1994", "authors": "Skinner H.B., Bankaitis V.A., McGee T.P.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "7961445", "url": "https://glygen.org/publication/PubMed/7961445" } ] }, { "title": "Phosphatidylcholine biosynthesis in Saccharomyces cerevisiae. Regulatory insights from studies employing null and chimeric sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "McMaster C.R., Bell R.M.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "7961735", "url": "https://glygen.org/publication/PubMed/7961735" } ] }, { "title": "Studies employing Saccharomyces cerevisiae cpt1 and ept1 null mutants implicate the CPT1 gene in coordinate regulation of phospholipid biosynthesis.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "McMaster C.R., Bell R.M., Hjelmstad R.H., Morash S.C.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "7961831", "url": "https://glygen.org/publication/PubMed/7961831" } ] }, { "title": "Phospholipid-synthesizing enzymes in Golgi membranes of the yeast, Saccharomyces cerevisiae.", "journal": "FEBS Lett.", "date": "1995", "authors": "Daum G., Hrastnik C., Leber A.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "8543066", "url": "https://glygen.org/publication/PubMed/8543066" } ] }, { "title": "A 43.5 kb segment of yeast chromosome XIV, which contains MFA2, MEP2, CAP/SRV2, NAM9, FKB1/FPR1/RBP1, MOM22 and CPT1, predicts an adenosine deaminase gene and 14 new open reading frames.", "journal": "Yeast", "date": "1995", "authors": "Jacquet M., Mallet L., Bussereau F.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "8619318", "url": "https://glygen.org/publication/PubMed/8619318" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] } ], "pathway": [ { "id": "sce:YNL130C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL130C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "CDP-choline pathway", "id": "GO:0006657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006657", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "pmid": "" }, { "name": "diacylglycerol cholinephosphotransferase activity", "id": "GO:0004142", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004142", "evidence": [ { "database": "UniProtKB", "id": "P17898", "url": "https://www.uniprot.org/uniprot/P17898" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 124, "end_pos": 126, "annotation": "n_glycosylation_sequon" }, { "start_pos": 260, "end_pos": 262, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "32939", "name": "", "equation": "a 1,2-diacyl-sn-glycerol + CDP-choline = a 1,2-diacyl-sn-glycero-3-phosphocholine + CMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q66H21-1", "Q6AXM5-1", "Q9Y6K0-1", "Q8WUD6-1", "Q8BGS7-1", "Q8C025-1", "P17898-1", "P22140-1" ], "evidence": [ { "id": "32939", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/32939" } ] }, { "id": "33775", "name": "", "equation": "a 1,2-diacyl-sn-glycerol + CDP-N,N-dimethylethanolamine = 1,2-diacyl-sn-glycero-3-phospho-N,N-dimethylethanolamine + CMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P17898-1", "P22140-1" ], "evidence": [ { "id": "33775", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/33775" } ] }, { "id": "R-SCE-1482961", "name": "CDP-Cho and DAG are converted to PC by CEPT1 at the ER membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-109395" ], "enzyme_list": [ "P17898-1", "P22140-1" ], "evidence": [ { "id": "R-SCE-1482961", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-1482961" } ] }, { "id": "R-SCE-1482962", "name": "CDP-ETA and DAG are converted to PE by CEPT1/EPT1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P17898-1", "P22140-1" ], "evidence": [ { "id": "R-SCE-1482962", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-1482962" } ] }, { "id": "R-SCE-1482973", "name": "CDP-Cho and DAG are converted to PC by CHPT1 at the Golgi membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi membrane, cytosol", "input_participant_list": [ "R-ALL-1524057" ], "output_participant_list": [ "R-ALL-429785" ], "enzyme_list": [ "P17898-1", "P22140-1" ], "evidence": [ { "id": "R-SCE-1482973", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-1482973" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-109395", "participant_name": "CMP [cytosol]", "crossref": [ { "id": "C00055", "database": "COMPOUND", "url": "" }, { "id": "60377", "database": "ChEBI", "url": "" }, { "id": "000003861744", "database": "ZINC", "url": "" }, { "id": "C00055", "database": "COMPOUND", "url": "" }, { "id": "60377", "database": "ChEBI", "url": "" }, { "id": "000003861744", "database": "ZINC", "url": "" }, { "id": "C00055", "database": "COMPOUND", "url": "" }, { "id": "60377", "database": "ChEBI", "url": "" }, { "id": "000003861744", "database": "ZINC", "url": "" }, { "id": "C00055", "database": "COMPOUND", "url": "" }, { "id": "60377", "database": "ChEBI", "url": "" }, { "id": "000003861744", "database": "ZINC", "url": "" }, { "id": "60377", "database": "ChEBI", "url": "" }, { "id": "C00055", "database": "COMPOUND", "url": "" }, { "id": "000003861744", "database": "ZINC", "url": "" }, { "id": "C00055", "database": "COMPOUND", "url": "" }, { "id": "60377", "database": "ChEBI", "url": "" }, { "id": "000003861744", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-1524057", "participant_name": "DAG [Golgi membrane]", "crossref": [ { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-429785", "participant_name": "PC [Golgi membrane]", "crossref": [ { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P17898", "gene_name": "CPT1", "activity": [ { "ec_number": "2.7.8.2", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + CDP-choline = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "P17898", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17898" } ] }, { "ec_number": "2.7.8.2", "activity": "", "evidence": [ { "id": "P17898", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17898" } ] } ] }, { "uniprot_ac": "P22140", "gene_name": "EPT1", "activity": [ { "ec_number": "2.7.8.2", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + CDP-choline = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "P22140", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22140" } ] }, { "ec_number": "2.7.8.1", "activity": "1-O-(1Z-alkenyl)-2-acyl-sn-glycerol + CDP-ethanolamine = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphoethanolamine + CMP + H(+).", "evidence": [ { "id": "P22140", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22140" } ] }, { "ec_number": "2.7.8.2", "activity": "", "evidence": [ { "id": "P22140", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22140" } ] }, { "ec_number": "2.7.8.1", "activity": "", "evidence": [ { "id": "P22140", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22140" } ] } ] }, { "uniprot_ac": "Q66H21", "gene_name": "Chpt1", "activity": [ { "ec_number": "2.7.8.2", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + CDP-choline = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q66H21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H21" } ] }, { "ec_number": "2.7.8.2", "activity": "", "evidence": [ { "id": "Q66H21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H21" } ] } ] }, { "uniprot_ac": "Q6AXM5", "gene_name": "Cept1", "activity": [ { "ec_number": "2.7.8.2", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + CDP-choline = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q6AXM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXM5" } ] }, { "ec_number": "2.7.8.1", "activity": "1-O-(1Z-alkenyl)-2-acyl-sn-glycerol + CDP-ethanolamine = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphoethanolamine + CMP + H(+).", "evidence": [ { "id": "Q6AXM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXM5" } ] }, { "ec_number": "2.7.8.22", "activity": "1-O-(1Z-alkenyl)-2-acyl-sn-glycerol + CDP-choline = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q6AXM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXM5" } ] }, { "ec_number": "2.7.8.2", "activity": "", "evidence": [ { "id": "Q6AXM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXM5" } ] }, { "ec_number": "2.7.8.1", "activity": "", "evidence": [ { "id": "Q6AXM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXM5" } ] } ] }, { "uniprot_ac": "Q8BGS7", "gene_name": "Cept1", "activity": [ { "ec_number": "2.7.8.2", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + CDP-choline = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q8BGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGS7" } ] }, { "ec_number": "2.7.8.1", "activity": "1-O-(1Z-alkenyl)-2-acyl-sn-glycerol + CDP-ethanolamine = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphoethanolamine + CMP + H(+).", "evidence": [ { "id": "Q8BGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGS7" } ] }, { "ec_number": "2.7.8.22", "activity": "1-O-(1Z-alkenyl)-2-acyl-sn-glycerol + CDP-choline = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q8BGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGS7" } ] }, { "ec_number": "2.7.8.2", "activity": "", "evidence": [ { "id": "Q8BGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGS7" } ] }, { "ec_number": "2.7.8.1", "activity": "", "evidence": [ { "id": "Q8BGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGS7" } ] } ] }, { "uniprot_ac": "Q8C025", "gene_name": "Chpt1", "activity": [ { "ec_number": "2.7.8.2", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + CDP-choline = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q8C025", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C025" } ] }, { "ec_number": "2.7.8.2", "activity": "", "evidence": [ { "id": "Q8C025", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C025" } ] } ] }, { "uniprot_ac": "Q8WUD6", "gene_name": "CHPT1", "activity": [ { "ec_number": "2.7.8.2", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + CDP-choline = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q8WUD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUD6" } ] }, { "ec_number": "2.7.8.2", "activity": "", "evidence": [ { "id": "Q8WUD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUD6" } ] } ] }, { "uniprot_ac": "Q9Y6K0", "gene_name": "CEPT1", "activity": [ { "ec_number": "2.7.8.2", "activity": "a 1-O-alkyl-2-acetyl-sn-glycerol + CDP-choline = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q9Y6K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K0" } ] }, { "ec_number": "2.7.8.1", "activity": "1-O-(1Z-alkenyl)-2-acyl-sn-glycerol + CDP-ethanolamine = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphoethanolamine + CMP + H(+).", "evidence": [ { "id": "Q9Y6K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K0" } ] }, { "ec_number": "2.7.8.22", "activity": "1-O-(1Z-alkenyl)-2-acyl-sn-glycerol + CDP-choline = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CMP + H(+).", "evidence": [ { "id": "Q9Y6K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K0" } ] }, { "ec_number": "2.7.8.2", "activity": "", "evidence": [ { "id": "Q9Y6K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K0" } ] }, { "ec_number": "2.7.8.1", "activity": "", "evidence": [ { "id": "Q9Y6K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }