{ "uniprot_canonical_ac": "P17533-1", "uniprot_ac": "P17533", "uniprot_id": "DFA29_MOUSE", "mass": { "chemical_mass": 12941.0, "monoisotopic_mass": 12941.0 }, "refseq": { "ac": "NP_031870", "name": "alpha-defensin 29 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031870" }, "gene_names": [ { "name": "Defa29", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P17533", "id": "P17533" }, { "name": "2010300L12Rik; 2010319H24Rik; CRS1C; CRS1C-2; CRS1C-4; CRS1C-5; Defa-rs1; Defcr-rs1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031870", "id": "NP_031870" }, { "name": "Defa-rs1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P17533", "id": "P17533" }, { "name": "Defa29", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031870", "id": "NP_031870" }, { "name": "Defcr-rs1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P17533", "id": "P17533" } ], "protein_names": [ { "name": "Alpha-defensin 29", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P17533" }, { "name": "Alpha-defensin-related sequence 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17533" }, { "name": "CRS1C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17533" }, { "name": "Cryptdin-related protein 1C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17533" }, { "name": "Defensin-related cryptdin-related sequence 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P17533" }, { "name": "alpha-defensin 29 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031870", "id": "NP_031870" }, { "name": "defensin-related cryptdin-related sequence 1; alpha-defensin-related sequence 1; cryptdin-related protein 1C; defensin related sequence cryptdin peptide (paneth cells); testis defensin; defensin, alpha, related sequence 1; alpha-defensin 29", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031870", "id": "NP_031870" } ], "function": [ { "annotation": "Apparent precursor of a secreted, cationic, proline- and cysteine-rich peptide that contains Cys-Pro-Xaa repeats (PubMed:2351676). Unlike cryptdin, the proposed mature peptide region lacks the structural motif characteristic of defensins (PubMed:2351676).", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533#function" }, { "database": "PubMed", "id": "2351676", "url": "https://glygen.org/publication/PubMed/2351676" } ] }, { "annotation": "Changes in gut microbiome correlate with intestinal barrier dysfunction and inflammation following a 3-day ethanol exposure in aged mice.", "evidence": [ { "database": "RefSeq", "id": "NP_031870", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031870" }, { "database": "PubMed", "id": "36150609", "url": "https://glygen.org/publication/PubMed/36150609" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Defa29", "url": "https://www.uniprot.org/uniprot/P17533", "locus": { "chromosome": "8", "start_pos": 21815903, "end_pos": 21817036, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000074437", "url": "https://www.ensembl.org/id/ENSMUSG00000074437" } ] } } ], "crossref": [ { "id": "ENSMUSG00000074437", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074437", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "13218", "url": "https://www.ncbi.nlm.nih.gov/gene/13218", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0003443", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0003443", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0007406", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007406", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR002366", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002366", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016327", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016327", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:13218", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13218", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "94881", "url": "http://www.informatics.jax.org/marker/MGI:94881", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PTHR11876", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11876", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11876:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11876:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00879", "url": "http://pfam.xfam.org/family/PF00879", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P17533", "url": "http://purl.obolibrary.org/obo/PR_P17533", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1461973", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1461973", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1462054", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P17533-1", "url": "https://www.uniprot.org/uniprot/P17533-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D815", "url": "https://www.uniprot.org/uniprot/Q9D815", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D815-1", "url": "https://www.uniprot.org/uniprot/Q9D815-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKTLVLLSALVLPCFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQRRFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC", "length": 116, "header": "sp|P17533-1|DFA29_MOUSE Isoform 1 of Alpha-defensin 29 OS=Mus musculus OX=10090 GN=Defa29 PE=2 SV=2 CANONICAL=P17533-1" }, "isoforms": [ { "isoform_ac": "P17533-1", "url": "", "sequence": { "sequence": "MKTLVLLSALVLPCFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQRRFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC", "length": 116, "header": "sp|P17533-1|DFA29_MOUSE Isoform 1 of Alpha-defensin 29 OS=Mus musculus OX=10090 GN=Defa29 PE=2 SV=2 CANONICAL=P17533-1" }, "locus": {} }, { "isoform_ac": "Q9D815-1", "url": "", "sequence": { "sequence": "MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQRRFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC", "length": 116, "header": "tr|Q9D815-1|Q9D815_MOUSE Computationally mapped isoform of Defensin related sequence cryptdin peptide (Paneth cells) OS=Mus musculus OX=10090 GN=Defa29 PE=2 SV=1 CANONICAL=P17533-1" }, "locus": { "chromosome": "8", "start_pos": 21816991, "end_pos": 21816018, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000098890.4", "url": "https://www.ensembl.org/id/ENSMUST00000098890.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000096489.4", "url": "https://www.ensembl.org/id/ENSMUSP00000096489.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A novel mouse gene family coding for cationic, cysteine-rich peptides. Regulation in small intestine and cells of myeloid origin.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Ouellette AJ, Lualdi JC", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "reference": [ { "type": "PubMed", "id": "2351676", "url": "https://glygen.org/publication/PubMed/2351676" } ] }, { "title": "Changes in gut microbiome correlate with intestinal barrier dysfunction and inflammation following a 3-day ethanol exposure in aged mice.", "journal": "Alcohol (Fayetteville, N.Y.)", "date": "2022-09-20", "authors": "McMahan Rachel H, Hulsebus Holly J, Najarro Kevin M, Giesy Lauren E, Frank Daniel N, Kovacs Elizabeth J", "evidence": [ { "database": "RefSeq", "id": "NP_031870", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031870" } ], "reference": [ { "type": "PubMed", "id": "36150609", "url": "https://glygen.org/publication/PubMed/36150609" } ] } ], "pathway": [ { "id": "mmu:13218", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13218", "resource": "KEGG Pathway" }, { "id": "R-MMU-1461973", "name": "Defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1461973", "resource": "Reactome", "description": "Defensins" }, { "id": "R-MMU-1462054", "name": "Alpha-defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1462054", "resource": "Reactome", "description": "Alpha-defensins" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P59666-1", "protein_name": "Neutrophil defensin 3", "gene_name": "DEFA3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC", "length": 94 }, "evidence": [ { "id": "45241015", "url": "http://www.informatics.jax.org/homology/45241015", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q01524-1", "protein_name": "Defensin-6", "gene_name": "DEFA6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL", "length": 100 }, "evidence": [ { "id": "45241015", "url": "http://www.informatics.jax.org/homology/45241015", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q4JEI2-1", "protein_name": "Defensin alpha-like protein 1", "gene_name": "Defal1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKTLILLSALVLLALQVQADPIQEAEEETKTEEQPADEDQDVSVSFEGPEASAVQDLRVRRTLQCSCRRVCRNTCSCIRLSRSTYAS", "length": 87 }, "evidence": [ { "id": "45241015", "url": "http://www.informatics.jax.org/homology/45241015", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q4JEI6-1", "protein_name": "Defensin alpha 8", "gene_name": "Defa8", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKTLVLLSALVLLAFQVQADHIQEAEEETKTEEQPADEDQDMSVSFEGPEASALQNLEIGWPLKQCHCRKFCRPYEKAEGSCRPGLFIKRKICCIQQWTPGRT", "length": 103 }, "evidence": [ { "id": "45241015", "url": "http://www.informatics.jax.org/homology/45241015", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" }, { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" }, { "name": "antimicrobial humoral immune response mediated by antimicrobial peptide", "id": "GO:0061844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061844", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" }, { "name": "innate immune response in mucosa", "id": "GO:0002227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002227", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" }, { "name": "perturbation of plasma membrane integrity in another organism", "id": "GO:0051673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051673", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P17533", "url": "https://www.uniprot.org/uniprot/P17533" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 100, "end_pos": 102, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }