{ "uniprot_canonical_ac": "P16858-1", "uniprot_ac": "P16858", "uniprot_id": "G3P_MOUSE", "mass": { "chemical_mass": 35810.0, "monoisotopic_mass": 35810.0 }, "refseq": { "ac": "NP_001276655", "name": "glyceraldehyde-3-phosphate dehydrogenase isoform 1", "summary": "This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The encoded protein was originally identified as a key glycolytic enzyme that converts D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Subsequent studies have assigned a variety of additional functions to the protein including nitrosylation of nuclear proteins, the regulation of mRNA stability, and acting as a transferrin receptor on the cell surface of macrophage. Alternative splicing results in multiple transcript variants. Many pseudogenes similar to this locus are found throughout the mouse genome. [provided by RefSeq, Jan 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" }, "gene_names": [ { "name": "Gapdh", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P16858", "id": "P16858" }, { "name": "Gapdh", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655", "id": "NP_001276655" }, { "name": "Gapd", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655", "id": "NP_001276655" }, { "name": "Gapd", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P16858", "id": "P16858" } ], "protein_names": [ { "name": "Glyceraldehyde-3-phosphate dehydrogenase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P16858" }, { "name": "1.2.1.12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16858" }, { "name": "2.6.99.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16858" }, { "name": "GAPDH", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16858" }, { "name": "Peptidyl-cysteine S-nitrosylase GAPDH", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16858" }, { "name": "glyceraldehyde-3-phosphate dehydrogenase isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655", "id": "NP_001276655" }, { "name": "peptidyl-cysteine S-nitrosylase GAPDH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655", "id": "NP_001276655" } ], "function": [ { "annotation": "GAPDH interacts with transferrin and the GAPDH-transferrin complex is subsequently internalized into the early endosomes. GeneRIF: Gapdh is a moonlighting protein that functions as a glycolytic enzyme and a transferrin receptor.", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" }, { "database": "PubMed", "id": "17121833", "url": "https://glygen.org/publication/PubMed/17121833" } ] }, { "annotation": "Gapdh is a moonlighting protein that functions as a glycolytic enzyme and a nuclear protein nitrosylase.", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" }, { "database": "PubMed", "id": "20972425", "url": "https://glygen.org/publication/PubMed/20972425" } ] }, { "annotation": "Gapdh is a moonlighting protein that functions as a glycolytic enzyme and additionally is involved in regulating mRNA stability.", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" }, { "database": "PubMed", "id": "18809573", "url": "https://glygen.org/publication/PubMed/18809573" } ] }, { "annotation": "Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively (PubMed:19903941). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate (PubMed:19903941). Modulates the organization and assembly of the cytoskeleton (By similarity). Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules (By similarity). Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes (PubMed:23071094). Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation (PubMed:23071094). Also plays a role in innate immunity by promoting TNF-induced NF-kappa-B activation and type I interferon production, via interaction with TRAF2 and TRAF3, respectively (By similarity). Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858#function" }, { "database": "UniProtKB", "id": "P04797", "url": "https://www.uniprot.org/uniprot/P04797#function" }, { "database": "PubMed", "id": "19903941", "url": "https://glygen.org/publication/PubMed/19903941" }, { "database": "PubMed", "id": "23071094", "url": "https://glygen.org/publication/PubMed/23071094" }, { "database": "UniProtKB", "id": "P10096", "url": "https://www.uniprot.org/uniprot/P10096#function" } ] }, { "annotation": "Oxidized GAPDH transfers S-glutathionylation to a nuclear protein Sirtuin-1 leading to apoptosis.", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" }, { "database": "PubMed", "id": "34332079", "url": "https://glygen.org/publication/PubMed/34332079" } ] }, { "annotation": "SUMOylation of Enzymes and Ion Channels in Sensory Neurons Protects against Metabolic Dysfunction, Neuropathy, and Sensory Loss in Diabetes.", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" }, { "database": "PubMed", "id": "32735781", "url": "https://glygen.org/publication/PubMed/32735781" } ] }, { "annotation": "This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The encoded protein was originally identified as a key glycolytic enzyme that converts D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Subsequent studies have assigned a variety of additional functions to the protein including nitrosylation of nuclear proteins, the regulation of mRNA stability, and acting as a transferrin receptor on the cell surface of macrophage. Alternative splicing results in multiple transcript variants. Many pseudogenes similar to this locus are found throughout the mouse genome. [provided by RefSeq, Jan 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" } ] } ], "disease": [ { "disease_id": "DOID:0050827", "recommended_name": { "id": "DOID:0050827", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050827", "name": "rheumatic heart disease", "description": "A heart valve disease that is characterized by repeated inflammation with fibrinous repair caused by an autoimmune reaction to Group A beta-hemolytic streptococci (GAS) that results in valvular damage. The cardinal anatomic changes of the valve include leaflet thickening, commissural fusion, and shortening and thickening of the tendinous cords." }, "synonyms": [ { "id": "DOID:0050827", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050827", "name": "rheumatic carditis", "description": "" } ], "evidence": [ { "id": "0050827", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050827" } ] }, { "disease_id": "DOID:0050866", "recommended_name": { "id": "DOID:0050866", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050866", "name": "oral squamous cell carcinoma", "description": "An oral cavity cancer that has_material_basis_in squamous cells." }, "synonyms": [ { "id": "DOID:0050866", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050866", "name": "mouth squamous cell carcinoma", "description": "" } ], "evidence": [ { "id": "0050866", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050866" } ] }, { "disease_id": "DOID:0060108", "recommended_name": { "id": "DOID:0060108", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060108", "name": "brain glioma", "description": "A brain cancer that has_material_basis_in glial cells." }, "synonyms": [ { "id": "DOID:0060108", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060108", "name": "lower grade glioma", "description": "" } ], "evidence": [ { "id": "0060108", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060108" } ] }, { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:1826", "recommended_name": { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy", "description": "A brain disease that is characterized by the occurrance of at least two unprovoked seizures resulting from a persistent epileptogenic abnormality of the brain that is able to spontaneously generate paroxysmal activity and typically manifested by sudden brief episodes of altered or diminished consciousness, involuntary movements, or convulsions." }, "synonyms": [ { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy syndrome", "description": "" }, { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epileptic syndrome", "description": "" } ], "evidence": [ { "id": "1826", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1826" } ] }, { "disease_id": "DOID:3319", "recommended_name": { "id": "DOID:3319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3319", "name": "lymphangioleiomyomatosis", "description": "A lung disease that is characterized by progressive cystic destruction of the lung and lymphatic abnormalities, frequently associated with renal angiomyolipomas." }, "synonyms": [ { "id": "DOID:3319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3319", "name": "lung lymphangioleiomyomatosis", "description": "" }, { "id": "DOID:3319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3319", "name": "lymphangiomyomatosis", "description": "" }, { "id": "DOID:3319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3319", "name": "pulmonary lymphangioleiomyomatosis", "description": "" }, { "id": "MONDO:0011705", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011705", "name": "lymphangioleiomyomatosis", "description": "A multifocal neoplasm with perivascular epithelioid cell differentiation affecting almost exclusively females of child-bearing age. It is characterized by the presence of smooth muscle and epithelioid cells and by the proliferation of lymphatic vessels. Sites of involvement include the lungs, mediastinum, and the retroperitoneum. It usually presents with chylous pleural effusion or ascites." }, { "id": "MONDO:0011705", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011705", "name": "lymphangioleiomyomatosis", "description": "" }, { "id": "MONDO:0011705", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011705", "name": "lymphangioleiomyomatosis, somatic", "description": "" }, { "id": "MONDO:0011705", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011705", "name": "lymphangiomyomatosis", "description": "" }, { "id": "MONDO:0011705", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011705", "name": "lung lymphangioleiomyomatosis", "description": "" }, { "id": "MONDO:0011705", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011705", "name": "pulmonary lymphangioleiomyomatosis", "description": "" }, { "id": "MONDO:0011705", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011705", "name": "LAM", "description": "" }, { "id": "MONDO:0011705", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011705", "name": "lymphangio-myomatosis", "description": "" }, { "id": "MIM:606690", "resource": "MIM", "url": "https://www.omim.org/entry/606690", "name": "Lymphangioleiomyomatosis", "description": "Lymphangioleiomyomatosis" } ], "evidence": [ { "id": "3319", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3319" } ] }, { "disease_id": "DOID:3525", "recommended_name": { "id": "DOID:3525", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3525", "name": "middle cerebral artery infarction", "description": "" }, "synonyms": [], "evidence": [ { "id": "3525", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3525" } ] }, { "disease_id": "DOID:8947", "recommended_name": { "id": "DOID:8947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8947", "name": "diabetic retinopathy", "description": "" }, "synonyms": [ { "id": "DOID:8947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8947", "name": "Retinal abnormality - diabetes-related", "description": "" } ], "evidence": [ { "id": "8947", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8947" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [ { "evidence": [ { "id": "rs3388862447", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388862447" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 144, "end_pos": 144, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IVS->NVS).", "chr_id": "6", "chr_pos": "125139894", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I144", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 150, "end_pos": 150, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes sulfhydration and induces impaired enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" }, { "database": "PubMed", "id": "19903941", "url": "https://glygen.org/publication/PubMed/19903941" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gapdh", "url": "https://www.uniprot.org/uniprot/P16858", "locus": { "chromosome": "6", "start_pos": 125138678, "end_pos": 125143430, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000057666", "url": "https://www.ensembl.org/id/ENSMUSG00000057666" } ] } } ], "crossref": [ { "id": "ENSMUSG00000057666", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000057666", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.2.1.12", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.2.1.12&UniProtAcc=P16858", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHEMBL3309048", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3309048", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "14433", "url": "https://www.ncbi.nlm.nih.gov/gene/14433", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0001181", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001181", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0003436", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0003436", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0007884", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007884", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0A0MQF6", "url": "https://www.ebi.ac.uk/intact/interactors/id:A0A0A0MQF6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P16858", "url": "https://www.ebi.ac.uk/intact/interactors/id:P16858*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006424", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006424", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020828", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020828", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020829", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020829", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020830", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020830", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020831", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020831", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:14433", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14433", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "95640", "url": "http://www.informatics.jax.org/marker/MGI:95640", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P16858", "url": "https://oglcnac.org/atlas/detail/P16858", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NRMLDNC", "url": "https://omabrowser.org/oma/group/NRMLDNC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "TCRIEKG", "url": "https://omabrowser.org/oma/group/TCRIEKG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "275384at2759", "url": "http://www.orthodb.org/?query=275384at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10836", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10836", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10836:SF111", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10836:SF111", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6LGJ", "url": "https://www.rcsb.org/structure/6LGJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LGK", "url": "https://www.rcsb.org/structure/6LGK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LGM", "url": "https://www.rcsb.org/structure/6LGM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00044", "url": "http://pfam.xfam.org/family/PF00044", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02800", "url": "http://pfam.xfam.org/family/PF02800", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P16858", "url": "http://purl.obolibrary.org/obo/PR_P16858", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70171", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70263", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "10300", "url": "https://www.rhea-db.org/rhea/10300", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66684", "url": "https://www.rhea-db.org/rhea/66684", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0A0MQF6", "url": "https://www.uniprot.org/uniprot/A0A0A0MQF6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MQF6-1", "url": "https://www.uniprot.org/uniprot/A0A0A0MQF6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P16858-1", "url": "https://www.uniprot.org/uniprot/P16858-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1N5", "url": "https://www.uniprot.org/uniprot/S4R1N5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1N5-1", "url": "https://www.uniprot.org/uniprot/S4R1N5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1W8", "url": "https://www.uniprot.org/uniprot/S4R1W8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1W8-1", "url": "https://www.uniprot.org/uniprot/S4R1W8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R257", "url": "https://www.uniprot.org/uniprot/S4R257", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R257-1", "url": "https://www.uniprot.org/uniprot/S4R257-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE", "length": 333, "header": "sp|P16858-1|G3P_MOUSE Isoform 1 of Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 CANONICAL=P16858-1" }, "isoforms": [ { "isoform_ac": "A0A0A0MQF6-1", "url": "", "sequence": { "sequence": "MLPLPRGPSLGSSGKLRRVFPRPVDKMVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE", "length": 359, "header": "tr|A0A0A0MQF6-1|A0A0A0MQF6_MOUSE Computationally mapped isoform of Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=1 CANONICAL=P16858-1" }, "locus": { "chromosome": "6", "start_pos": 125143416, "end_pos": 125138998, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000117757.9", "url": "https://www.ensembl.org/id/ENSMUST00000117757.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000113942.3", "url": "https://www.ensembl.org/id/ENSMUSP00000113942.3" } ] } }, { "isoform_ac": "P16858-1", "url": "", "sequence": { "sequence": "MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE", "length": 333, "header": "sp|P16858-1|G3P_MOUSE Isoform 1 of Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 CANONICAL=P16858-1" }, "locus": { "chromosome": "6", "start_pos": 125142256, "end_pos": 125138998, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000073605", "url": "https://www.ensembl.org/id/ENSMUST00000073605" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000073289", "url": "https://www.ensembl.org/id/ENSMUSP00000073289" } ] } }, { "isoform_ac": "S4R1N5-1", "url": "", "sequence": { "sequence": "MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGT", "length": 57, "header": "tr|S4R1N5-1|S4R1N5_MOUSE Computationally mapped isoform of Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=1 CANONICAL=P16858-1" }, "locus": { "chromosome": "6", "start_pos": 125142256, "end_pos": 125140252, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000182277.2", "url": "https://www.ensembl.org/id/ENSMUST00000182277.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138295.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138295.2" } ] } }, { "isoform_ac": "S4R1W8-1", "url": "", "sequence": { "sequence": "MVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVE", "length": 55, "header": "tr|S4R1W8-1|S4R1W8_MOUSE Computationally mapped isoform of Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=1 CANONICAL=P16858-1" }, "locus": { "chromosome": "6", "start_pos": 125140302, "end_pos": 125140138, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000182052.8", "url": "https://www.ensembl.org/id/ENSMUST00000182052.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138403.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138403.2" } ] } }, { "isoform_ac": "S4R257-1", "url": "", "sequence": { "sequence": "MVKYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVV", "length": 280, "header": "tr|S4R257-1|S4R257_MOUSE Computationally mapped isoform of Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=1 CANONICAL=P16858-1" }, "locus": { "chromosome": "6", "start_pos": 125142256, "end_pos": 125139028, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000183272.2", "url": "https://www.ensembl.org/id/ENSMUST00000183272.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138508.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138508.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 208, "start_aa": "Ser", "end_pos": 208, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser208", "evidence": [ { "id": "P16858", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" }, { "id": "30031227", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30031227" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "25153642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153642" }, { "id": "28135057", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28135057" }, { "id": "22517741", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22517741" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" }, { "id": "28528544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28528544" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "P16858", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16858" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 209, "start_aa": "Thr", "end_pos": 209, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr209", "evidence": [ { "id": "P16858", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16858" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] } ], "phosphorylation": [ { "start_pos": 120, "end_pos": 120, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Ser120" }, { "start_pos": 146, "end_pos": 146, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Ser146" }, { "start_pos": 149, "end_pos": 149, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Ser149" }, { "start_pos": 151, "end_pos": 151, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Thr151" }, { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Thr175" }, { "start_pos": 180, "end_pos": 180, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Thr180" }, { "start_pos": 182, "end_pos": 182, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Thr182" }, { "start_pos": 209, "end_pos": 209, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" }, { "database": "phospho.ELM", "id": "P16858", "url": "http://phospho.elm.eu.org/byAccession/P16858.html" }, { "database": "iPTMnet", "id": "P16858", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16858" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ], "site_lbl": "Thr209" }, { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Thr227" }, { "start_pos": 235, "end_pos": 235, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Thr235" }, { "start_pos": 239, "end_pos": 239, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Ser239" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Ser310" }, { "start_pos": 316, "end_pos": 316, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P16858", "url": "http://phospho.elm.eu.org/byAccession/P16858.html" }, { "database": "iPTMnet", "id": "P16858", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16858" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ], "site_lbl": "Tyr316" }, { "start_pos": 331, "end_pos": 331, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Ser331" }, { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Tyr40" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "site_lbl": "Thr73" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P16858", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16858" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "Housekeeping genes for phylogenetic analysis of eutherian relationships.", "journal": "Mol. Biol. Evol.", "date": "2006", "authors": "Kullberg M, Nilsson MA, Arnason U, Harley EH, Janke A", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "reference": [ { "type": "PubMed", "id": "16751257", "url": "https://glygen.org/publication/PubMed/16751257" } ] }, { "title": "The macrophage cell surface glyceraldehyde-3-phosphate dehydrogenase is a novel transferrin receptor.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Raje CI, Kumar S, Harle A, Nanda JS, Raje M", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" } ], "reference": [ { "type": "PubMed", "id": "17121833", "url": "https://glygen.org/publication/PubMed/17121833" } ] }, { "title": "Large-scale phosphorylation analysis of mouse liver.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Villen J, Beausoleil SA, Gerber SA, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P16858", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16858" } ], "reference": [ { "type": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ] }, { "title": "Glyceraldehyde-3-phosphate dehydrogenase regulates endothelin-1 expression by a novel, redox-sensitive mechanism involving mRNA stability.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Rodriguez-Pascual F, Redondo-Horcajo M, Magan-Marchal N, Lagares D, Martinez-Ruiz A, Kleinert H, Lamas S", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" } ], "reference": [ { "type": "PubMed", "id": "18809573", "url": "https://glygen.org/publication/PubMed/18809573" } ] }, { "title": "H2S signals through protein S-sulfhydration.", "journal": "Sci. Signal.", "date": "2009", "authors": "Mustafa AK, Gadalla MM, Sen N, Kim S, Mu W, Gazi SK, Barrow RK, Yang G, Wang R, Snyder SH", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "reference": [ { "type": "PubMed", "id": "19903941", "url": "https://glygen.org/publication/PubMed/19903941" } ] }, { "title": "GAPDH mediates nitrosylation of nuclear proteins.", "journal": "Nature cell biology", "date": "2010", "authors": "Kornberg MD, Sen N, Hara MR, Juluri KR, Nguyen JV, Snowman AM, Law L, Hester LD, Snyder SH", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" } ], "reference": [ { "type": "PubMed", "id": "20972425", "url": "https://glygen.org/publication/PubMed/20972425" } ] }, { "title": "Glyceraldehyde-3-phosphate dehydrogenase mRNA is a major interleukin 2-induced transcript in a cloned T-helper lymphocyte.", "journal": "Gene", "date": "1990", "authors": "Sabath D.E., Prystowsky M.B., Broome H.E.", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "reference": [ { "type": "PubMed", "id": "2145197", "url": "https://glygen.org/publication/PubMed/2145197" } ] }, { "title": "Tandem mass spectrometry identifies many mouse brain O-GlcNAcylated proteins including EGF domain-specific O-GlcNAc transferase targets.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Alfaro JF, Gong CX, Monroe ME, Aldrich JT, Clauss TR, Purvine SO, Wang Z, Camp DG 2nd, Shabanowitz J, Stanley P, Hart GW, Hunt DF, Yang F, Smith RD", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" }, { "database": "O-GlcNAc Atlas", "id": "P16858", "url": "https://oglcnac.org/atlas/detail/P16858" } ], "reference": [ { "type": "PubMed", "id": "22517741", "url": "https://glygen.org/publication/PubMed/22517741" } ] }, { "title": "Heterotrimeric GAIT complex drives transcript-selective translation inhibition in murine macrophages.", "journal": "Mol. Cell. Biol.", "date": "2012", "authors": "Arif A, Chatterjee P, Moodt RA, Fox PL", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "reference": [ { "type": "PubMed", "id": "23071094", "url": "https://glygen.org/publication/PubMed/23071094" } ] }, { "title": "Changes in metabolic chemical reporter structure yield a selective probe of O-GlcNAc modification.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Chuh KN, Zaro BW, Piller F, Piller V, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" } ], "reference": [ { "type": "PubMed", "id": "25153642", "url": "https://glygen.org/publication/PubMed/25153642" } ] }, { "title": "The Small Molecule 2-Azido-2-deoxy-glucose Is a Metabolic Chemical Reporter of O-GlcNAc Modifications in Mammalian Cells, Revealing an Unexpected Promiscuity of O-GlcNAc Transferase.", "journal": "ACS chemical biology", "date": "2017", "authors": "Zaro BW, Batt AR, Chuh KN, Navarro MX, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" } ], "reference": [ { "type": "PubMed", "id": "28135057", "url": "https://glygen.org/publication/PubMed/28135057" } ] }, { "title": "The New Chemical Reporter 6-Alkynyl-6-deoxy-GlcNAc Reveals O-GlcNAc Modification of the Apoptotic Caspases That Can Block the Cleavage/Activation of Caspase-8.", "journal": "Journal of the American Chemical Society", "date": "2017", "authors": "Chuh KN, Batt AR, Zaro BW, Darabedian N, Marotta NP, Brennan CK, Amirhekmat A, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" } ], "reference": [ { "type": "PubMed", "id": "28528544", "url": "https://glygen.org/publication/PubMed/28528544" } ] }, { "title": "Proteomic identification of altered protein O-GlcNAcylation in a triple transgenic mouse model of Alzheimer's disease.", "journal": "Biochimica et biophysica acta. Molecular basis of disease", "date": "2018", "authors": "Tramutola A, Sharma N, Barone E, Lanzillotta C, Castellani A, Iavarone F, Vincenzoni F, Castagnola M, Butterfield DA, Gaetani S, Cassano T, Perluigi M, Di Domenico F", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" } ], "reference": [ { "type": "PubMed", "id": "30031227", "url": "https://glygen.org/publication/PubMed/30031227" } ] }, { "title": "SUMOylation of Enzymes and Ion Channels in Sensory Neurons Protects against Metabolic Dysfunction, Neuropathy, and Sensory Loss in Diabetes.", "journal": "Neuron", "date": "2020", "authors": "Agarwal N, Taberner FJ, Rangel Rojas D, Moroni M, Omberbasic D, Njoo C, Andrieux A, Gupta P, Bali KK, Herpel E, Faghihi F, Fleming T, Dejean A, Lechner SG, Nawroth PP, Lewin GR, Kuner R", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" } ], "reference": [ { "type": "PubMed", "id": "32735781", "url": "https://glygen.org/publication/PubMed/32735781" } ] }, { "title": "Cytosolic N-GlcNAc proteins are formed by the action of endo-beta-N-acetylglucosaminidase.", "journal": "Biochemical and biophysical research communications", "date": "2020", "authors": "Maynard JC, Fujihira H, Dolgonos GE, Suzuki T, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P16858", "url": "https://oglcnac.org/atlas/detail/P16858" } ], "reference": [ { "type": "PubMed", "id": "32782141", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "title": "Age-related loss of neural stem cell O-GlcNAc promotes a glial fate switch through STAT3 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "White CW 3rd, Fan X, Maynard JC, Wheatley EG, Bieri G, Couthouis J, Burlingame AL, Villeda SA", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P16858", "url": "https://oglcnac.org/atlas/detail/P16858" } ], "reference": [ { "type": "PubMed", "id": "32848054", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "Oxidized GAPDH transfers S-glutathionylation to a nuclear protein Sirtuin-1 leading to apoptosis.", "journal": "Free radical biology & medicine", "date": "2021", "authors": "Mustafa Rizvi SH, Shao D, Tsukahara Y, Pimentel DR, Weisbrod RM, Hamburg NM, McComb ME, Matsui R, Bachschmid MM", "evidence": [ { "database": "RefSeq", "id": "NP_001276655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001276655" } ], "reference": [ { "type": "PubMed", "id": "34332079", "url": "https://glygen.org/publication/PubMed/34332079" } ] }, { "title": "Defining the Dynamic Regulation of O-GlcNAc Proteome in the Mouse Cortex---the O-GlcNAcylation of Synaptic and Trafficking Proteins Related to Neurodegenerative Diseases.", "journal": "Frontiers in aging", "date": "2021", "authors": "Huynh Van N, Wang Sheng, Ouyang Xiaosen, Wani Willayat Y, Johnson Michelle S, Chacko Balu K, Jegga Anil G, Qian Wei-Jun, Chatham John C, Darley-Usmar Victor M, Zhang Jianhua", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" } ], "reference": [ { "type": "PubMed", "id": "35822049", "url": "https://glygen.org/publication/PubMed/35822049" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] }, { "title": "Chemoproteomic and Transcriptomic Analysis Reveals that O-GlcNAc Regulates Mouse Embryonic Stem Cell Fate through the Pluripotency Network.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2023-02-27", "authors": "Hao Yi, Li Xiang, Qin Ke, Shi Yujie, He Yanwen, Zhang Che, Cheng Bo, Zhang Xiwen, Hu Guangyu, Liang Shuyu, Tang Qi, Chen Xing", "evidence": [ { "database": "O-GlcNAc Database", "id": "P16858", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16858" } ], "reference": [ { "type": "PubMed", "id": "36852467", "url": "https://glygen.org/publication/PubMed/36852467" } ] } ], "pathway": [ { "id": "mmu:14433", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14433", "resource": "KEGG Pathway" }, { "id": "R-MMU-70171", "name": "Glycolysis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70171", "resource": "Reactome", "description": "Glycolysis" }, { "id": "R-MMU-70263", "name": "Gluconeogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70263", "resource": "Reactome", "description": "Gluconeogenesis" } ], "orthologs": [ { "uniprot_canonical_ac": "P00359-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase 3", "gene_name": "TDH3", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MVRVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKA", "length": 332 }, "evidence": [ { "id": "P16858", "url": "https://omabrowser.org/oma/group/P16858/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P04406-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase", "gene_name": "GAPDH", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE", "length": 335 }, "evidence": [ { "id": "45235566", "url": "http://www.informatics.jax.org/homology/45235566", "database": "MGI" }, { "id": "P16858", "url": "https://omabrowser.org/oma/group/P16858/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P04797-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase", "gene_name": "Gapdh", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE", "length": 333 }, "evidence": [ { "id": "45235566", "url": "http://www.informatics.jax.org/homology/45235566", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P07487-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase 2", "gene_name": "Gapdh2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSKIGINGFGRIGRLVLRAAIDKGANVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGGAKKVIISAPSADAPMFVCGVNLDAYKPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGASYDEIKAKVQEAANGPLKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD", "length": 332 }, "evidence": [ { "id": "P16858", "url": "https://omabrowser.org/oma/group/P16858/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 15, "go_terms": [ { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "late endosome lumen", "id": "GO:0031906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031906", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "lipid droplet", "id": "GO:0005811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005811", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "myelin sheath", "id": "GO:0043209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043209", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "microtubule cytoskeleton", "id": "GO:0015630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015630", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "GAIT complex", "id": "GO:0097452", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097452", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "postsynaptic density, intracellular component", "id": "GO:0099092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099092", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "microtubule binding", "id": "GO:0008017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "NAD binding", "id": "GO:0051287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051287", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "disordered domain specific binding", "id": "GO:0097718", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097718", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity", "id": "GO:0004365", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004365", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "aspartic-type endopeptidase inhibitor activity", "id": "GO:0019828", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019828", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "peptidyl-cysteine S-nitrosylase activity", "id": "GO:0035605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035605", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "NADP binding", "id": "GO:0050661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050661", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor", "id": "GO:0016620", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016620", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 21, "go_terms": [ { "name": "neuron apoptotic process", "id": "GO:0051402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051402", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "antimicrobial humoral immune response mediated by antimicrobial peptide", "id": "GO:0061844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061844", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "cAMP-mediated signaling", "id": "GO:0019933", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019933", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "positive regulation of cytokine production", "id": "GO:0001819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "gluconeogenesis", "id": "GO:0006094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006094", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "positive regulation of I-kappaB kinase/NF-kappaB signaling", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "nitric oxide mediated signal transduction", "id": "GO:0007263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007263", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "negative regulation of translation", "id": "GO:0017148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017148", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "microtubule cytoskeleton organization", "id": "GO:0000226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000226", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "glycolytic process", "id": "GO:0006096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006096", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "canonical glycolysis", "id": "GO:0061621", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061621", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "killing of cells of another organism", "id": "GO:0031640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031640", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "negative regulation of endopeptidase activity", "id": "GO:0010951", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010951", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "killing by host of symbiont cells", "id": "GO:0051873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051873", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "positive regulation of type I interferon production", "id": "GO:0032481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032481", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "defense response to fungus", "id": "GO:0050832", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050832", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "peptidyl-cysteine S-trans-nitrosylation", "id": "GO:0035606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035606", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "negative regulation of vascular associated smooth muscle cell apoptotic process", "id": "GO:1905460", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905460", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" }, { "name": "glucose metabolic process", "id": "GO:0006006", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006006", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 147, "end_pos": 149, "annotation": "n_glycosylation_sequon" }, { "start_pos": 237, "end_pos": 239, "annotation": "n_glycosylation_sequon" }, { "start_pos": 55, "end_pos": 57, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "ISGylated.", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" }, { "database": "PubMed", "id": "P04406", "url": "https://glygen.org/publication/PubMed/P04406" } ] }, { "annotation": "Oxidative stress can promote the formation of high molecular weight disulfide-linked GAPDH aggregates, through a process called nucleocytoplasmic coagulation.", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" }, { "database": "PubMed", "id": "P04406", "url": "https://glygen.org/publication/PubMed/P04406" } ] }, { "annotation": "S-nitrosylation of Cys-150 leads to interaction with SIAH1, followed by translocation to the nucleus S-nitrosylation of Cys-245 is induced by interferon-gamma and LDL(ox) implicating the iNOS-S100A8/9 transnitrosylase complex and seems to prevent interaction with phosphorylated RPL13A and to interfere with GAIT complex activity (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" }, { "database": "PubMed", "id": "P04406", "url": "https://glygen.org/publication/PubMed/P04406" }, { "database": "PubMed", "id": "P04797", "url": "https://glygen.org/publication/PubMed/P04797" } ] }, { "annotation": "Succination of Cys-150 and Cys-245 by the Krebs cycle intermediate fumarate, which leads to S-(2-succinyl)cysteine residues, inhibits glyceraldehyde-3-phosphate dehydrogenase activity. Fumarate concentration as well as succination of cysteine residues in GAPDH is significantly increased in muscle of diabetic mammals. It was proposed that the S-(2-succinyl)cysteine chemical modification may be a useful biomarker of mitochondrial and oxidative stress in diabetes and that succination of GAPDH and other thiol proteins by fumarate may contribute to the metabolic changes underlying the development of diabetes complications.", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" }, { "database": "PubMed", "id": "P04797", "url": "https://glygen.org/publication/PubMed/P04797" } ] }, { "annotation": "Sulfhydration at Cys-150 increases catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P16858", "url": "https://www.uniprot.org/uniprot/P16858" }, { "database": "PubMed", "id": "19903941", "url": "https://glygen.org/publication/PubMed/19903941" } ] } ], "interactions": [], "reactions": [ { "id": "10300", "name": "", "equation": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04797-1", "F1LUV3-1", "Q9ESV6-1", "A0A0G2K7M1-1", "E9PTV9-1", "E9PTN6-1", "M0R660-1", "O14556-1", "P04406-1", "P16858-1", "Q64467-1", "A0A1D5RLD8-1", "S4R1W1-1", "P00358-1", "P00359-1", "P00360-1", "Q94469-1", "P07486-1", "P07487-1", "Q7JY07-1" ], "evidence": [ { "id": "10300", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10300" } ] }, { "id": "66684", "name": "", "equation": "L-cysteinyl-[protein] + S-nitroso-L-cysteinyl-[GAPDH] = L-cysteinyl-[GAPDH] + S-nitroso-L-cysteinyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K7M1-1", "E9PTV9-1", "F1LUV3-1", "E9PTN6-1", "M0R660-1", "Q9ESV6-1", "P04797-1", "P04406-1", "P16858-1", "A0A1D5RLD8-1", "S4R1W1-1", "Q64467-1" ], "evidence": [ { "id": "66684", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66684" } ] }, { "id": "R-MMU-70449", "name": "D-glyceraldehyde 3-phosphate + orthophosphate + NAD+ <=> 1,3-bisphospho-D-glycerate + NADH + H+", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P16858-1", "Q64467-1" ], "evidence": [ { "id": "R-MMU-70449", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70449" } ] }, { "id": "R-MMU-70482", "name": "GAPDH tetramers reduce 1,3BPG to GA3P", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P16858-1", "Q64467-1" ], "evidence": [ { "id": "R-MMU-70482", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70482" } ] }, { "id": "R-MMU-9631076", "name": "Hspa8:substrate binds late endosomal phospholipids", "equation": "", "summary": "Microautophagy (MI) can target KFERQ motif containing protein substrates to endosomal degradation. Upon binding with Hspa8, substrates are transported from the cytosol to late endosomes. Here, Hspa8 binds with the phospholipids on the late endosomal membrane. This interaction facilitates the vesicle-mediated transport of Hspa8:substrate complex into the late endosomes for degradation (Sahu R et al. 2011).", "cellular_location": "cytosol, late endosome membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P63017-1", "P16858-1" ], "evidence": [ { "id": "R-MMU-9631076", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9631076" } ] }, { "id": "R-MMU-9631080", "name": "Substrate translocates into late endosomal lumen", "equation": "", "summary": "In addition to bulk protein degradation, Microautophagy (MI) can also target KFERQ motif protein substrates similar to Chaperone Mediated Autophagy (CMA). However, MI is distinct from CMA in that it occurs during late endosomes/multivesicular bodies formation. Upon binding with Hspa8, substrates are transported from the cytosol to late endosomes. Hspa8 binds with the phospholipids on the late endosomal membrane. Subsequently, the substrate is transported into the lumen via endosomal sorting complexes required for transport (ESCRTI and ESCRTIII systems) (Sahu R et al. 2011). This event is represented as a black box since the precise molecular mechanism of the substrate transport into the endosomal lumen is unclear.", "cellular_location": "cytosol, late endosome membrane, late endosome lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P63017-1", "P16858-1" ], "evidence": [ { "id": "R-MMU-9631080", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9631080" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K7M1", "gene_name": "AABR07030729.1", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "A0A0G2K7M1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K7M1" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "A0A0G2K7M1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K7M1" } ] } ] }, { "uniprot_ac": "A0A1D5RLD8", "gene_name": "Gm10358", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "A0A1D5RLD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5RLD8" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "A0A1D5RLD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1D5RLD8" } ] } ] }, { "uniprot_ac": "E9PTN6", "gene_name": "LOC108352348", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "E9PTN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTN6" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "E9PTN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTN6" } ] } ] }, { "uniprot_ac": "E9PTV9", "gene_name": "AABR07032392.1", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "E9PTV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTV9" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "E9PTV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTV9" } ] } ] }, { "uniprot_ac": "F1LUV3", "gene_name": "ENSRNOG00000066746", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "F1LUV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LUV3" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "F1LUV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LUV3" } ] } ] }, { "uniprot_ac": "M0R660", "gene_name": "AABR07070043.1", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "M0R660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R660" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "M0R660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R660" } ] } ] }, { "uniprot_ac": "O14556", "gene_name": "GAPDHS", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "O14556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14556" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "O14556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14556" } ] } ] }, { "uniprot_ac": "P00358", "gene_name": "TDH2", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "P00358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00358" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "P00358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00358" } ] } ] }, { "uniprot_ac": "P00359", "gene_name": "TDH3", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "P00359", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00359" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "P00359", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00359" } ] } ] }, { "uniprot_ac": "P00360", "gene_name": "TDH1", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "P00360", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00360" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "P00360", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00360" } ] } ] }, { "uniprot_ac": "P04406", "gene_name": "GAPDH", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "P04406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04406" } ] }, { "ec_number": "2.6.99.-", "activity": "", "evidence": [ { "id": "P04406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04406" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "P04406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04406" } ] } ] }, { "uniprot_ac": "P04797", "gene_name": "Gapdh", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "P04797", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04797" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "P04797", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04797" } ] }, { "ec_number": "2.6.99.-", "activity": "", "evidence": [ { "id": "P04797", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04797" } ] } ] }, { "uniprot_ac": "P07486", "gene_name": "Gapdh1", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "P07486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07486" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "P07486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07486" } ] } ] }, { "uniprot_ac": "P07487", "gene_name": "Gapdh2", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "P07487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07487" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "P07487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07487" } ] } ] }, { "uniprot_ac": "P16858", "gene_name": "Gapdh", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "P16858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16858" } ] }, { "ec_number": "2.6.99.-", "activity": "", "evidence": [ { "id": "P16858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16858" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "P16858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16858" } ] } ] }, { "uniprot_ac": "P63017", "gene_name": "Hspa8", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P63017", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63017" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P63017", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63017" } ] } ] }, { "uniprot_ac": "Q64467", "gene_name": "Gapdhs", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "Q64467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64467" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "Q64467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64467" } ] } ] }, { "uniprot_ac": "Q7JY07", "gene_name": "anon-WO0140519.132", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "Q7JY07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JY07" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "Q7JY07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JY07" } ] } ] }, { "uniprot_ac": "Q94469", "gene_name": "gpdA", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "Q94469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94469" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "Q94469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94469" } ] } ] }, { "uniprot_ac": "Q9ESV6", "gene_name": "Gapdhs", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "Q9ESV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESV6" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "Q9ESV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESV6" } ] } ] }, { "uniprot_ac": "S4R1W1", "gene_name": "Gapdhrt", "activity": [ { "ec_number": "1.2.1.12", "activity": "D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH.", "evidence": [ { "id": "S4R1W1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/S4R1W1" } ] }, { "ec_number": "1.2.1.12", "activity": "", "evidence": [ { "id": "S4R1W1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/S4R1W1" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }