{ "uniprot_canonical_ac": "P16573-1", "uniprot_ac": "P16573", "uniprot_id": "CEAM1_RAT", "mass": { "chemical_mass": 57410.0, "monoisotopic_mass": 57410.0 }, "refseq": { "ac": "NP_001029033", "name": "carcinoembryonic antigen-related cell adhesion molecule 1 isoform 2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029033" }, "gene_names": [ { "name": "Ceacam1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P16573", "id": "P16573" }, { "name": "Bgp; BGPR; Ccam1; CD66a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029032", "id": "NP_001029032" }, { "name": "Ceacam1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029032", "id": "NP_001029032" } ], "protein_names": [ { "name": "Carcinoembryonic antigen-related cell adhesion molecule 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P16573" }, { "name": "ATP-dependent taurocolate-carrier protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16573" }, { "name": "C-CAM 105", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16573" }, { "name": "Cell-CAM 105", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16573" }, { "name": "Ecto-ATPase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16573" }, { "name": "GP110; pp120; C-CAM 105; ecto-ATPase; cell-CAM 105; ATP-dependent taurocolate-carrier protein; bone gamma-carboxyglutamic acid (Gla) protein; osteocalcin; CEA-related cell adhesion molecule 1 (bone gamma-carboxyglutamic acid (Gla) protein) (osteocalcin); carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein); pp120/ecto-ATPase; carcinoembryonic antigen related cell adhesion molecule 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113943", "id": "NP_113943" }, { "name": "GP110", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16573" }, { "name": "carcinoembryonic antigen-related cell adhesion molecule 1 isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029032", "id": "NP_001029032" }, { "name": "carcinoembryonic antigen-related cell adhesion molecule 1 isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029033", "id": "NP_001029033" }, { "name": "carcinoembryonic antigen-related cell adhesion molecule 1 isoform 4 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113943", "id": "NP_113943" }, { "name": "pp120", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P16573" } ], "function": [ { "annotation": "CEACAM8 interacts with CEACAM1 inhibiting TLR2-triggered immune responses Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_113943", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113943" }, { "database": "PubMed", "id": "24743304", "url": "https://glygen.org/publication/PubMed/24743304" }, { "database": "RefSeq", "id": "NP_001029032", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029032" }, { "database": "RefSeq", "id": "NP_001029033", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029033" } ] }, { "annotation": "Cell adhesion protein that mediates homophilic cell adhesion in a calcium-independent manner (PubMed:8454589, PubMed:2373740). Plays a role as coinhibitory receptor in immune response, insulin action and functions also as an activator during angiogenesis (PubMed:11850617). Its coinhibitory receptor function is phosphorylation- and PTPN6 -dependent, which in turn, suppress signal transduction of associated receptors by dephosphorylation of their downstream effectors (By similarity). Plays a role in immune response, of T-cells, natural killer (NK) and neutrophils (By similarity). Upon TCR/CD3 complex stimulation, inhibits TCR-mediated cytotoxicity by blocking granule exocytosis by mediating homophilic binding to adjacent cells, allowing interaction with and phosphorylation by LCK and interaction with the TCR/CD3 complex which recruits PTPN6 resulting in dephosphorylation of CD247 and ZAP70 (By similarity). Also inhibits T-cell proliferation and cytokine production through inhibition of JNK cascade and plays a crucial role in regulating autoimmunity and anti-tumor immunity by inhibiting T-cell through its interaction with HAVCR2 (By similarity). Upon natural killer (NK) cells activation, inhibit KLRK1-mediated cytolysis of CEACAM1-bearing tumor cells by trans-homophilic interactions with CEACAM1 on the target cell and lead to cis-interaction between CEACAM1 and KLRK1, allowing PTPN6 recruitment and then VAV1 dephosphorylation (By similarity). Upon neutrophils activation negatively regulates IL1B production by recruiting PTPN6 to a SYK-TLR4-CEACAM1 complex, that dephosphorylates SYK, reducing the production of reactive oxygen species (ROS) and lysosome disruption, which in turn, reduces the activity of the inflammasome (By similarity). Down-regulates neutrophil production by acting as a coinhibitory receptor for CSF3R by downregulating the CSF3R-STAT3 pathway through recruitment of PTPN6 that dephosphorylates CSF3R (By similarity). Also regulates insulin action by promoting INS clearance and regulating lipogenesis in liver through regulating insulin signaling (PubMed:11850617). Upon INS stimulation, undergoes phosphorylation by INSR leading to INS clearance by increasing receptor-mediated insulin endocytosis (PubMed:7592607, PubMed:9712832). This inernalization promotes interaction with FASN leading to receptor-mediated insulin degradation and to reduction of FASN activity leading to negative regulation of fatty acid synthesis (PubMed:7592607, PubMed:16054098). INSR-mediated phosphorylation also provokes a down-regulation of cell proliferation through SHC1 interaction resulting in decrease coupling of SHC1 to the MAPK3/ERK1-MAPK1/ERK2 and phosphatidylinositol 3-kinase pathways (PubMed:11694516). Functions as activator in angiogenesis by promoting blood vessel remodeling through endothelial cell differentiation and migration and in arteriogenesis by increasing the number of collateral arteries and collateral vessel calibers after ischemia (By similarity). Also regulates vascular permeability through the VEGFR2 signaling pathway resulting in control of nitric oxide production (By similarity). Down-regulates cell growth in response to EGF through its interaction with SHC1 that mediates interaction with EGFR resulting in decrease coupling of SHC1 to the MAPK3/ERK1-MAPK1/ERK2 pathway (PubMed:15467833). Negatively regulates platelet aggregation by decreasing platelet adhesion on type I collagen through the GPVI-FcRgamma complex (By similarity). Inhibits cell migration and cell scattering through interaction with FLNA; interfers with the interaction of FLNA with RALA (By similarity). Mediates bile acid transport activity in a phosphorylation dependent manner (PubMed:7518458). Negatively regulates osteoclastogenesis (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573#function" }, { "database": "PubMed", "id": "8454589", "url": "https://glygen.org/publication/PubMed/8454589" }, { "database": "PubMed", "id": "11850617", "url": "https://glygen.org/publication/PubMed/11850617" }, { "database": "PubMed", "id": "7592607", "url": "https://glygen.org/publication/PubMed/7592607" }, { "database": "UniProtKB", "id": "P13688", "url": "https://www.uniprot.org/uniprot/P13688#function" }, { "database": "PubMed", "id": "7518458", "url": "https://glygen.org/publication/PubMed/7518458" }, { "database": "PubMed", "id": "2373740", "url": "https://glygen.org/publication/PubMed/2373740" }, { "database": "PubMed", "id": "11694516", "url": "https://glygen.org/publication/PubMed/11694516" }, { "database": "PubMed", "id": "9712832", "url": "https://glygen.org/publication/PubMed/9712832" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" }, { "database": "UniProtKB", "id": "P31809", "url": "https://www.uniprot.org/uniprot/P31809#function" }, { "database": "PubMed", "id": "15467833", "url": "https://glygen.org/publication/PubMed/15467833" } ] }, { "annotation": "Cell adhesion proteins that mediates homophilic cell adhesion in a calcium-independent manner (PubMed:8536699, PubMed:7774714). Promotes populations of T-cells regulating IgA production and secretion associated with control of the commensal microbiota and resistance to enteropathogens (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573#function" }, { "database": "PubMed", "id": "7774714", "url": "https://glygen.org/publication/PubMed/7774714" }, { "database": "PubMed", "id": "8536699", "url": "https://glygen.org/publication/PubMed/8536699" }, { "database": "UniProtKB", "id": "P31809", "url": "https://www.uniprot.org/uniprot/P31809#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 488, "end_pos": 488, "sequence_org": "Y", "sequence_mut": "F", "comment": "Phosphorylated on serine. Decreases bile acid transport Doesn't phosphorylated by EGFR. Doesn't increase interaction with SHC1. Completely inhibits insulin-stimulated phosphorylation. No effect on INSR internalization and INS degradation. Prevents CEACAM1 phosphorylation and the increase in its binding to FASN in the presence of INSR. No effect on cell-surface expression in response to INS. Abolishes phosphorylation by INSR. Abolishes indirect interaction with INSR.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "PubMed", "id": "7592607", "url": "https://glygen.org/publication/PubMed/7592607" }, { "database": "PubMed", "id": "7626603", "url": "https://glygen.org/publication/PubMed/7626603" }, { "database": "PubMed", "id": "7518458", "url": "https://glygen.org/publication/PubMed/7518458" }, { "database": "PubMed", "id": "9712832", "url": "https://glygen.org/publication/PubMed/9712832" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" }, { "database": "PubMed", "id": "15467833", "url": "https://glygen.org/publication/PubMed/15467833" } ] }, { "start_pos": 502, "end_pos": 503, "sequence_org": "TS", "sequence_mut": "AA", "comment": "Phosphorylated on tyrosine. Impairs bile acid transport.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "PubMed", "id": "7518458", "url": "https://glygen.org/publication/PubMed/7518458" } ] }, { "start_pos": 503, "end_pos": 503, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation by EGFR. Reduces interaction with SHC1. Completely inhibits insulin-stimulated phosphorylation. No effect on INSR internalization and INS degradation. In L-SACC1; completely inhibits insulin-stimulated phosphorylation; develops hyperinsulinemia resulting from impaired insulin clearance; the hyperinsulinemia causes secondary insulin resistance with impaired glucose tolerance and random, but not fasting, hyperglycemia; insulin doesn't significantly decrease FASN activity in liver. Prevents CEACAM1 phosphorylation and the increase in its binding to FASN in the presence of INSR. No effect on cell-surface expression in response to INS.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "PubMed", "id": "11850617", "url": "https://glygen.org/publication/PubMed/11850617" }, { "database": "PubMed", "id": "7592607", "url": "https://glygen.org/publication/PubMed/7592607" }, { "database": "PubMed", "id": "7626603", "url": "https://glygen.org/publication/PubMed/7626603" }, { "database": "PubMed", "id": "11694516", "url": "https://glygen.org/publication/PubMed/11694516" }, { "database": "PubMed", "id": "9712832", "url": "https://glygen.org/publication/PubMed/9712832" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" }, { "database": "PubMed", "id": "15467833", "url": "https://glygen.org/publication/PubMed/15467833" } ] }, { "start_pos": 503, "end_pos": 503, "sequence_org": "S", "sequence_mut": "D", "comment": "Preserves the ability of INSR to induce CEACAM1 phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" } ] }, { "start_pos": 513, "end_pos": 513, "sequence_org": "Y", "sequence_mut": "F", "comment": "Increases INSR internalization and INS degradation. Phosphorylated by INSR. Prevents the increase in CEACAM1 binding to FASN by INSR. Decreases cell-surface expression in response to INS. Doesn't affect phosphorylation by INSR.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "PubMed", "id": "7592607", "url": "https://glygen.org/publication/PubMed/7592607" }, { "database": "PubMed", "id": "9712832", "url": "https://glygen.org/publication/PubMed/9712832" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ceacam1", "url": "https://www.uniprot.org/uniprot/P16573", "locus": { "chromosome": "1", "start_pos": 81043595, "end_pos": 81059992, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000020578", "url": "https://www.ensembl.org/id/ENSRNOG00000020578" } ] } } ], "crossref": [ { "id": "ENSRNOG00000020578", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000020578", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05740", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05740", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05774", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05774", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20948", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20948", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "81613", "url": "https://www.ncbi.nlm.nih.gov/gene/81613", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013151", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013151", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:81613", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:81613", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VAYVIRT", "url": "https://omabrowser.org/oma/group/VAYVIRT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3033616at2759", "url": "http://www.orthodb.org/?query=3033616at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR44427", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44427", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR44427:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44427:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00047", "url": "http://pfam.xfam.org/family/PF00047", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "http://pfam.xfam.org/family/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13895", "url": "http://pfam.xfam.org/family/PF13895", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13927", "url": "http://pfam.xfam.org/family/PF13927", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P16573", "url": "http://purl.obolibrary.org/obo/PR_P16573", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-1566977", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1566977", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-163125", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001029032", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029032", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "67396", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=67396", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6A3J5", "url": "https://www.uniprot.org/uniprot/A0A8I6A3J5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A3J5-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A3J5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ACX8", "url": "https://www.uniprot.org/uniprot/A0A8I6ACX8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ACX8-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ACX8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7F6B2", "url": "https://www.uniprot.org/uniprot/F7F6B2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7F6B2-1", "url": "https://www.uniprot.org/uniprot/F7F6B2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P16573-1", "url": "https://www.uniprot.org/uniprot/P16573-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P16573-2", "url": "https://www.uniprot.org/uniprot/P16573-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JHL6", "url": "https://www.uniprot.org/uniprot/Q9JHL6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JHL6-1", "url": "https://www.uniprot.org/uniprot/Q9JHL6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JHL7", "url": "https://www.uniprot.org/uniprot/Q9JHL7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JHL7-1", "url": "https://www.uniprot.org/uniprot/Q9JHL7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSPNKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK", "length": 519, "header": "sp|P16573-1|CEAM1_RAT Isoform 1 of Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4 CANONICAL=P16573-1" }, "isoforms": [ { "isoform_ac": "A0A8I6A3J5-1", "url": "", "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTDQPHNENWCPVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK", "length": 509, "header": "tr|A0A8I6A3J5-1|A0A8I6A3J5_RAT Computationally mapped isoform of CEA cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=1 CANONICAL=P16573-1" }, "locus": { "chromosome": "1", "start_pos": 81059929, "end_pos": 81045554, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000103781.1", "url": "https://www.ensembl.org/id/ENSRNOT00000103781.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000085270.1", "url": "https://www.ensembl.org/id/ENSRNOP00000085270.1" } ] } }, { "isoform_ac": "A0A8I6ACX8-1", "url": "", "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYQPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSPNKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK", "length": 341, "header": "tr|A0A8I6ACX8-1|CEAM1_RAT Computationally mapped isoform of Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=1 CANONICAL=P16573-1" }, "locus": { "chromosome": "1", "start_pos": 81059929, "end_pos": 81045554, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000111729.1", "url": "https://www.ensembl.org/id/ENSRNOT00000111729.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000089582.1", "url": "https://www.ensembl.org/id/ENSRNOP00000089582.1" } ] } }, { "isoform_ac": "F7F6B2-1", "url": "", "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIRLFDSCSLTTFASLHFVCSDHAQERRSEGAL", "length": 442, "header": "tr|F7F6B2-1|F7F6B2_RAT Computationally mapped isoform of CEA cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=1 CANONICAL=P16573-1" }, "locus": { "chromosome": "1", "start_pos": 81059929, "end_pos": 81053308, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000027214.5", "url": "https://www.ensembl.org/id/ENSRNOT00000027214.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000027213.4", "url": "https://www.ensembl.org/id/ENSRNOP00000027213.4" } ] } }, { "isoform_ac": "P16573-1", "url": "", "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSPNKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK", "length": 519, "header": "sp|P16573-1|CEAM1_RAT Isoform 1 of Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4 CANONICAL=P16573-1" }, "locus": { "chromosome": "1", "start_pos": 81059929, "end_pos": 81045554, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000051892", "url": "https://www.ensembl.org/id/ENSRNOT00000051892" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000046654", "url": "https://www.ensembl.org/id/ENSRNOP00000046654" } ] } }, { "isoform_ac": "P16573-2", "url": "", "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGSGSF", "length": 458, "header": "sp|P16573-2|CEAM1_RAT Isoform 2 of Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4 CANONICAL=P16573-1" }, "locus": { "chromosome": "1", "start_pos": 81059929, "end_pos": 81046753, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000090629", "url": "https://www.ensembl.org/id/ENSRNOT00000090629" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074820", "url": "https://www.ensembl.org/id/ENSRNOP00000074820" } ] } }, { "isoform_ac": "Q9JHL6-1", "url": "", "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIHLGPSDDSPNKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK", "length": 459, "header": "tr|Q9JHL6-1|Q9JHL6_RAT Computationally mapped isoform of CEA cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=4 SV=1 CANONICAL=P16573-1" }, "locus": { "chromosome": "1", "start_pos": 81059929, "end_pos": 81045554, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000027933.7", "url": "https://www.ensembl.org/id/ENSRNOT00000027933.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000027933.4", "url": "https://www.ensembl.org/id/ENSRNOP00000027933.4" } ] } }, { "isoform_ac": "Q9JHL7-1", "url": "", "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIREVTIEISQSTNPQPPATIWVLLTTLLTRWMTSHTLS", "length": 448, "header": "tr|Q9JHL7-1|Q9JHL7_RAT Computationally mapped isoform of CEA cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=4 SV=1 CANONICAL=P16573-1" }, "locus": { "chromosome": "1", "start_pos": 81059929, "end_pos": 81045640, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000029487.8", "url": "https://www.ensembl.org/id/ENSRNOT00000029487.8" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000031260.4", "url": "https://www.ensembl.org/id/ENSRNOP00000031260.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 104, "start_aa": "Asn", "end_pos": 104, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn104", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 113, "start_aa": "Asn", "end_pos": 113, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn113", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 148, "start_aa": "Asn", "end_pos": 148, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn148", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 173, "start_aa": "Asn", "end_pos": 173, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn173", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 224, "start_aa": "Asn", "end_pos": 224, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn224", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 256, "start_aa": "Asn", "end_pos": 256, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn256", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 292, "start_aa": "Asn", "end_pos": 292, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn292", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 302, "start_aa": "Asn", "end_pos": 302, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn302", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 315, "start_aa": "Asn", "end_pos": 315, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn315", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 331, "start_aa": "Asn", "end_pos": 331, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn331", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine; atypical", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 87, "start_aa": "Asn", "end_pos": 87, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn87", "evidence": [ { "id": "P16573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16573#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] } ], "phosphorylation": [ { "start_pos": 488, "end_pos": 488, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC, LCK, INSR and EGFR", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" }, { "database": "PubMed", "id": "7626603", "url": "https://glygen.org/publication/PubMed/7626603" }, { "database": "PubMed", "id": "9642150", "url": "https://glygen.org/publication/PubMed/9642150" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" }, { "database": "PubMed", "id": "7518458", "url": "https://glygen.org/publication/PubMed/7518458" }, { "database": "PubMed", "id": "9712832", "url": "https://glygen.org/publication/PubMed/9712832" }, { "database": "PubMed", "id": "15467833", "url": "https://glygen.org/publication/PubMed/15467833" } ], "site_lbl": "Tyr488" }, { "start_pos": 503, "end_pos": 503, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "PubMed", "id": "7518458", "url": "https://glygen.org/publication/PubMed/7518458" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" }, { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" }, { "database": "PubMed", "id": "7626603", "url": "https://glygen.org/publication/PubMed/7626603" }, { "database": "PubMed", "id": "9642150", "url": "https://glygen.org/publication/PubMed/9642150" } ], "site_lbl": "Ser503" }, { "start_pos": 513, "end_pos": 513, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by INSR, SRC and LCK", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" }, { "database": "PubMed", "id": "7626603", "url": "https://glygen.org/publication/PubMed/7626603" }, { "database": "PubMed", "id": "9642150", "url": "https://glygen.org/publication/PubMed/9642150" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" } ], "site_lbl": "Tyr513" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "Redefined nomenclature for members of the carcinoembryonic antigen family.", "journal": "Exp. Cell Res.", "date": "1999", "authors": "Beauchemin N, Draber P, Dveksler G, Gold P, Gray-Owen S, Grunert F, Hammarstrom S, Holmes KV, Karlsson A, Kuroki M, Lin SH, Lucka L, Najjar SM, Neumaier M, Obrink B, Shively JE, Skubitz KM, Stanners CP, Thomas P, Thompson JA, Virji M, von Kleist S, Wagener C, Watt S, Zimmermann W", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "11501563", "url": "https://glygen.org/publication/PubMed/11501563" } ] }, { "title": "Shc and CEACAM1 interact to regulate the mitogenic action of insulin.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Poy MN, Ruch RJ, Fernstrom MA, Okabayashi Y, Najjar SM", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "11694516", "url": "https://glygen.org/publication/PubMed/11694516" } ] }, { "title": "CEACAM1 regulates insulin clearance in liver.", "journal": "Nat. Genet.", "date": "2002", "authors": "Poy MN, Yang Y, Rezaei K, Fernstrom MA, Lee AD, Kido Y, Erickson SK, Najjar SM", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "11850617", "url": "https://glygen.org/publication/PubMed/11850617" } ] }, { "title": "Carcinoembryonic antigen-related cell adhesion molecule 1 expression and signaling in human, mouse, and rat leukocytes: evidence for replacement of the short cytoplasmic domain isoform by glycosylphosphatidylinositol-linked proteins in human leukocytes.", "journal": "J. Immunol.", "date": "2002", "authors": "Obrink B., Heymann R., Kammerer R., Scheffrahn I., Sigmundsson K., Singer B.B.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "11994468", "url": "https://glygen.org/publication/PubMed/11994468" } ] }, { "title": "CEACAM1 modulates epidermal growth factor receptor--mediated cell proliferation.", "journal": "J. Clin. Invest.", "date": "2004", "authors": "Abou-Rjaily GA, Lee SJ, May D, Al-Share QY, Deangelis AM, Ruch RJ, Neumaier M, Kalthoff H, Lin SH, Najjar SM", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" } ], "reference": [ { "type": "PubMed", "id": "15467833", "url": "https://glygen.org/publication/PubMed/15467833" } ] }, { "title": "Insulin acutely decreases hepatic fatty acid synthase activity.", "journal": "Cell metabolism", "date": "2005", "authors": "Najjar SM, Yang Y, Fernstrom MA, Lee SJ, Deangelis AM, Rjaily GA, Al-Share QY, Dai T, Miller TA, Ratnam S, Ruch RJ, Smith S, Lin SH, Beauchemin N, Oyarce AM", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" } ], "reference": [ { "type": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" } ] }, { "title": "CEACAM1 functionally interacts with filamin A and exerts a dual role in the regulation of cell migration.", "journal": "J. Cell Sci.", "date": "2005", "authors": "Kannicht C., Klaile E., Lucka L., Mueller M.M., Singer B.B.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "16291724", "url": "https://glygen.org/publication/PubMed/16291724" } ] }, { "title": "Molecular cloning and expression of a new rat liver cell-CAM105 isoform. Differential phosphorylation of isoforms.", "journal": "Biochem. J.", "date": "1992", "authors": "Culic O, Huang QH, Flanagan D, Hixson D, Lin SH", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "1637321", "url": "https://glygen.org/publication/PubMed/1637321" } ] }, { "title": "Immunochemical characterization of two isoforms of rat liver ecto-ATPase that show an immunological and structural identity with a glycoprotein cell-adhesion molecule with Mr 105,000.", "journal": "Biochem. J.", "date": "1991", "authors": "Lin SH, Culic O, Flanagan D, Hixson DC", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "1831973", "url": "https://glygen.org/publication/PubMed/1831973" } ] }, { "title": "Homophilic adhesion and CEACAM1-S regulate dimerization of CEACAM1-L and recruitment of SHP-2 and c-Src.", "journal": "J. Cell Biol.", "date": "2009", "authors": "Obrink B., Klaile E., Mueller M.M., Singer B.B., Vorontsova O.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "19948503", "url": "https://glygen.org/publication/PubMed/19948503" } ] }, { "title": "The cell adhesion molecule Cell-CAM 105 is an ecto-ATPase and a member of the immunoglobulin superfamily.", "journal": "FEBS Lett.", "date": "1990", "authors": "Hansen O.C., Bock E., Oebrink B., Aurivillius M., Lazrek M.B.S.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "2141577", "url": "https://glygen.org/publication/PubMed/2141577" } ] }, { "title": "C-CAM (cell-CAM 105) is an adhesive cell surface glycoprotein with homophilic binding properties.", "journal": "J. Cell Sci.", "date": "1990", "authors": "Obrink B., Aurivillius M., Blikstad I., Tingstroem A.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "2373740", "url": "https://glygen.org/publication/PubMed/2373740" } ] }, { "title": "Soluble CEACAM8 interacts with CEACAM1 inhibiting TLR2-triggered immune responses.", "journal": "PloS one", "date": "2014", "authors": "Singer BB, Opp L, Heinrich A, Schreiber F, Binding-Liermann R, Berrocal-Almanza LC, Heyl KA, Muller MM, Weimann A, Zweigner J, Slevogt H", "evidence": [ { "database": "RefSeq", "id": "NP_001029032", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029032" }, { "database": "RefSeq", "id": "NP_001029033", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001029033" }, { "database": "RefSeq", "id": "NP_113943", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113943" } ], "reference": [ { "type": "PubMed", "id": "24743304", "url": "https://glygen.org/publication/PubMed/24743304" } ] }, { "title": "Cloning and expression of a cDNA coding for a rat liver plasma membrane ecto-ATPase. The primary structure of the ecto-ATPase is similar to that of the human biliary glycoprotein I.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Guidotti G., Lin S.-H.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "2527235", "url": "https://glygen.org/publication/PubMed/2527235" } ] }, { "title": "Bile acid efflux mediated by the rat liver canalicular bile acid transport/ecto-ATPase protein requires serine 503 phosphorylation and is regulated by tyrosine 488 phosphorylation.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Sippel CJ, Fallon RJ, Perlmutter DH", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" } ], "reference": [ { "type": "PubMed", "id": "7518458", "url": "https://glygen.org/publication/PubMed/7518458" } ] }, { "title": "Receptor-mediated internalization of insulin. Potential role of pp120/HA4, a substrate of the insulin receptor kinase.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Formisano P, Najjar SM, Gross CN, Philippe N, Oriente F, Kern-Buell CL, Accili D, Gorden P", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "7592607", "url": "https://glygen.org/publication/PubMed/7592607" } ] }, { "title": "Insulin-stimulated phosphorylation of recombinant pp120/HA4, an endogenous substrate of the insulin receptor tyrosine kinase.", "journal": "Biochemistry", "date": "1995", "authors": "Najjar SM, Philippe N, Suzuki Y, Ignacio GA, Formisano P, Accili D, Taylor SI", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" } ], "reference": [ { "type": "PubMed", "id": "7626603", "url": "https://glygen.org/publication/PubMed/7626603" } ] }, { "title": "Cell adhesion activity of the short cytoplasmic domain isoform of C-CAM (C-CAM2) in CHO cells.", "journal": "FEBS Lett.", "date": "1995", "authors": "Obrink B., Olsson H., Kjellstroem G., Wikstroem K.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "7774714", "url": "https://glygen.org/publication/PubMed/7774714" } ] }, { "title": "The cytoplasmic domain of C-CAM is required for C-CAM-mediated adhesion function: studies of a C-CAM transcript containing an unspliced intron.", "journal": "Biochem. J.", "date": "1993", "authors": "Qiu Y., Thompson N., Lin S.-H., Hixson D.C., Culic O., Cheung P.H., Earley K.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8240240", "url": "https://glygen.org/publication/PubMed/8240240" } ] }, { "title": "pp120/ecto-ATPase, an endogenous substrate of the insulin receptor tyrosine kinase, is expressed as two variably spliced isoforms.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Philippe N., Accili D., Taylor S.I., Jernberg J., Margolis R., Najjae S.M.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8380406", "url": "https://glygen.org/publication/PubMed/8380406" } ] }, { "title": "The rat liver ecto-ATPase is also a canalicular bile acid transport protein.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Sippel CJ, Suchy FJ, Ananthanarayanan M, Perlmutter DH", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8420979", "url": "https://glygen.org/publication/PubMed/8420979" } ] }, { "title": "Cell-CAM105 isoforms with different adhesion functions are coexpressed in adult rat tissues and during liver development.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Lin S.H., Culic O., Cheung P.H., Earley K., Hixson D., Thompson N.L.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8454589", "url": "https://glygen.org/publication/PubMed/8454589" } ] }, { "title": "Different isoforms and stock-specific variants of the cell adhesion molecule C-CAM (cell-CAM 105) in rat liver.", "journal": "Eur. J. Biochem.", "date": "1993", "authors": "Edlund M, Gaardsvoll H, Bock E, Obrink B", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8504806", "url": "https://glygen.org/publication/PubMed/8504806" } ] }, { "title": "Characterisation of the ATP-dependent taurocholate-carrier protein (gp110) of the hepatocyte canalicular membrane.", "journal": "Eur. J. Biochem.", "date": "1993", "authors": "Kannicht C., Lucka L., Becker A., Reutter W., Kilian C.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8513803", "url": "https://glygen.org/publication/PubMed/8513803" } ] }, { "title": "A short isoform of carcinoembryonic-antigen-related rat liver cell-cell adhesion molecule (C-CAM/gp110) mediates intercellular adhesion. Sequencing and recombinant functional analysis.", "journal": "Eur. J. Biochem.", "date": "1995", "authors": "Lucka L., Reutter W., Baeumler K., Bechler K., Cichocka I.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8536699", "url": "https://glygen.org/publication/PubMed/8536699" } ] }, { "title": "Calmodulin binds to specific sequences in the cytoplasmic domain of C-CAM and down-regulates C-CAM self-association.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Obrink B., Edlund M., Blikstad I.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8576129", "url": "https://glygen.org/publication/PubMed/8576129" } ] }, { "title": "Homophilic intercellular adhesion mediated by C-CAM is due to a domain 1-domain 1 reciprocal binding.", "journal": "Exp. Cell Res.", "date": "1996", "authors": "Obrink B., Kjellstroem G., Wikstroem K.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "8831574", "url": "https://glygen.org/publication/PubMed/8831574" } ] }, { "title": "Evidence for regulated dimerization of cell-cell adhesion molecule (C-CAM) in epithelial cells.", "journal": "Biochem. J.", "date": "1996", "authors": "Sawa H., Obrink B., Edlund M., Hunter I.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "reference": [ { "type": "PubMed", "id": "9003371", "url": "https://glygen.org/publication/PubMed/9003371" } ] }, { "title": "pp120, a substrate of the insulin receptor tyrosine kinase, is associated with phosphatase activity.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Najjar SM", "evidence": [ { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" } ], "reference": [ { "type": "PubMed", "id": "9642150", "url": "https://glygen.org/publication/PubMed/9642150" } ] }, { "title": "Insulin stimulates pp120 endocytosis in cells co-expressing insulin receptors.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Choice CV, Howard MJ, Poy MN, Hankin MH, Najjar SM", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "iPTMnet", "id": "P16573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16573" } ], "reference": [ { "type": "PubMed", "id": "9712832", "url": "https://glygen.org/publication/PubMed/9712832" } ] } ], "pathway": [ { "id": "rno:81613", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:81613", "resource": "KEGG Pathway" }, { "id": "R-RNO-1566977", "name": "Fibronectin matrix formation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1566977", "resource": "Reactome", "description": "Fibronectin matrix formation" }, { "id": "R-RNO-163125", "name": "Post-translational modification: synthesis of GPI-anchored proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-163125", "resource": "Reactome", "description": "Post-translational modification: synthesis of GPI-anchored proteins" }, { "id": "R-RNO-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" }, { "id": "R-RNO-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P06731-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 5", "gene_name": "CEACAM5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI", "length": 702 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP", "length": 419 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 1", "gene_name": "CEACAM1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ", "length": 526 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P31809-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 1", "gene_name": "Ceacam1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHPILLKPNITSNNSNPVEGDDSVSLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGGSDQRDLTEHKPSTSNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEVKKK", "length": 521 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 6", "gene_name": "CEACAM6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI", "length": 344 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLPAPSCTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTDLYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPGVKRPIENRILILPSVTRNETGPYQCEIRDRYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQITRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGDLTESQS", "length": 426 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLSAPPCTQRITWKGVLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTFTLHLETPKPSISSSNLNPREAMEAVILTCDPATPAASYQWWMNGQSLPMTHRLQLSKTNRTLFIFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLSKPYITINNLNPRENKDVLTFTCEPKSKNYTYIWWLNGQSLPVSPRVKRPIENRILILPNVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPRAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSITVKVSDWILP", "length": 419 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLSAPPCTQHITWKGLLLTASLLNFWNLPTTAQVIIEAKPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETVYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSISSSNLNPREVMEAVRLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPMPYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLDLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSETASPQVTYAGPNTWFQEILLL", "length": 435 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLSAPPCTQHITWKGLLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYVTSYIVDGQIIKYGPAYSGRETVYSNASLLIQNVTQEDTGSYTLHIIKRGDGTGGVTGRFTFTLYLETPKPSISSSNFNPREATEAVILTCDPETPDASYLWWMNGQSLPMTHSLQLSETNRTLYLFGVTNYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVSTFTCEPKSENYTYIWWLNGQSLPVSPRVKRRIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYHSGQNLYLSCFADSNPPAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSVTVRVSDWTLP", "length": 419 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLSAPPCTQRITWKGLLLTALLLNFWNLPTTAQVTIEAEPTKVSKGKDVLLLVHNLPQNLAGYIWYKGQMKDLYHYITSYVVDGQIIIYGPAYSGRETVYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPSISSSNLYPREDMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLQLSKNKRTLFLFGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIQDRYGGIRSYPVTLNVLYGPDLPRIYPSFTYYHSGENLYLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSATGMESSKSMTVKVSAPSGTGHLPGLNPL", "length": 428 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q925P2-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 2", "gene_name": "Ceacam2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELASAHLHKGQVPWFGLLLTASLLASWSPPTTAQVTVMAFPLHAAEGNNVILVVYNMMKGVSAFSWHKGSTTSTNAEIVRFVTGTNKTIKGPVHSGRETLYSNGSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHVHTLLLKSNITSNNSNPVEGDDSVSLTCDSYTDPDNITYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPSLQVTNTTVKELDSVTLTCLSKDRQAHIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNPVSVKRSNSIKLEVIFDSTYDISDVPIAVIITGAVAGVILIAGLAYRLCSRKSRWGSDQRDLTEHKPSASNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEVKKK", "length": 520 }, "evidence": [ { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGLLSAPPCTQRITWKGLLLTASLLNFWNPPTTAQVTIEAQPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRETIYSNASLLIQNVTQEDAGSYTLHIIMGGDENRGVTGHFTFTLYLETPKPSISSSKLNPREAMEAVSLTCDPETPDASYLWWMNGQSLPMSHRLQLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPFTLNLLPKLPKPYITINNLKPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDQYGGIRSYPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKRIPVSLAIGI", "length": 426 }, "evidence": [ { "id": "45240781", "url": "http://www.informatics.jax.org/homology/45240781", "database": "MGI" }, { "id": "45233396", "url": "http://www.informatics.jax.org/homology/45233396", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 15, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "cell-cell junction", "id": "GO:0005911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005911", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "adherens junction", "id": "GO:0005912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005912", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "cell junction", "id": "GO:0030054", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030054", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "transport vesicle", "id": "GO:0030133", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030133", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "lateral plasma membrane", "id": "GO:0016328", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016328", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "brush border membrane", "id": "GO:0031526", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031526", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "basal plasma membrane", "id": "GO:0009925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009925", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "ciliary membrane", "id": "GO:0060170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060170", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "microvillus membrane", "id": "GO:0031528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031528", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 48, "go_terms": [ { "name": "negative regulation of interleukin-2 production", "id": "GO:0032703", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032703", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "cellular response to insulin stimulus", "id": "GO:0032869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032869", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of fatty acid biosynthetic process", "id": "GO:0045717", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045717", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of protein kinase activity", "id": "GO:0006469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006469", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "bile acid and bile salt transport", "id": "GO:0015721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015721", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of T cell proliferation", "id": "GO:0042130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042130", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of vascular permeability", "id": "GO:0043116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043116", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of immune system process", "id": "GO:0002682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002682", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of phosphatidylinositol 3-kinase signaling", "id": "GO:0014066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014066", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "positive regulation of MAP kinase activity", "id": "GO:0043406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043406", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of cell growth", "id": "GO:0001558", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001558", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "blood vessel development", "id": "GO:0001568", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001568", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "cell-cell adhesion via plasma-membrane adhesion molecules", "id": "GO:0098742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098742", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of cell migration", "id": "GO:0030334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030334", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "positive regulation of memory T cell activation", "id": "GO:2000568", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000568", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "positive regulation of CD8-positive, alpha-beta T cell activation", "id": "GO:2001187", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001187", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "homophilic cell adhesion via plasma membrane adhesion molecules", "id": "GO:0007156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007156", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of endothelial cell differentiation", "id": "GO:0045601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045601", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of granulocyte differentiation", "id": "GO:0030853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030853", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "positive regulation of vasculogenesis", "id": "GO:2001214", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001214", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of ERK1 and ERK2 cascade", "id": "GO:0070372", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070372", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of lipid biosynthetic process", "id": "GO:0051055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051055", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of osteoclast differentiation", "id": "GO:0045671", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045671", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of bone resorption", "id": "GO:0045779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045779", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of T cell mediated cytotoxicity", "id": "GO:0001915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001915", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target", "id": "GO:0002859", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002859", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of interleukin-1 production", "id": "GO:0032692", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032692", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "common myeloid progenitor cell proliferation", "id": "GO:0035726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035726", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "insulin receptor internalization", "id": "GO:0038016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038016", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "granulocyte colony-stimulating factor signaling pathway", "id": "GO:0038158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038158", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of cytotoxic T cell degranulation", "id": "GO:0043318", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043318", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of T cell receptor signaling pathway", "id": "GO:0050860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050860", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of blood vessel remodeling", "id": "GO:0060312", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060312", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "insulin catabolic process", "id": "GO:1901143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901143", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of homophilic cell adhesion", "id": "GO:1903385", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903385", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of sprouting angiogenesis", "id": "GO:1903670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903670", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "positive regulation of homophilic cell adhesion", "id": "GO:1903387", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903387", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of hepatocyte proliferation", "id": "GO:2000346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000346", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of cytokine production", "id": "GO:0001818", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001818", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of endothelial cell migration", "id": "GO:0010594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010594", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "negative regulation of platelet aggregation", "id": "GO:0090331", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090331", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "wound healing, spreading of cells", "id": "GO:0044319", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044319", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "regulation of epidermal growth factor receptor signaling pathway", "id": "GO:0042058", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042058", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "cell-cell junction organization", "id": "GO:0045216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045216", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "positive regulation of CD4-positive, alpha-beta T cell activation", "id": "GO:2000516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000516", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "memory T cell activation", "id": "GO:0035709", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035709", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 14, "go_terms": [ { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "calmodulin binding", "id": "GO:0005516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005516", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "kinase binding", "id": "GO:0019900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "protein phosphatase binding", "id": "GO:0019903", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019903", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "bile acid transmembrane transporter activity", "id": "GO:0015125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015125", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "Toll-like receptor binding", "id": "GO:0035325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035325", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "filamin binding", "id": "GO:0031005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031005", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "granulocyte colony-stimulating factor receptor binding", "id": "GO:0005130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005130", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "protein tyrosine kinase binding", "id": "GO:1990782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990782", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" }, { "name": "virion binding", "id": "GO:0046790", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046790", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 104, "end_pos": 106, "annotation": "n_glycosylation_sequon" }, { "start_pos": 113, "end_pos": 115, "annotation": "n_glycosylation_sequon" }, { "start_pos": 148, "end_pos": 150, "annotation": "n_glycosylation_sequon" }, { "start_pos": 152, "end_pos": 154, "annotation": "n_glycosylation_sequon" }, { "start_pos": 172, "end_pos": 174, "annotation": "n_glycosylation_sequon" }, { "start_pos": 173, "end_pos": 175, "annotation": "n_glycosylation_sequon" }, { "start_pos": 197, "end_pos": 199, "annotation": "n_glycosylation_sequon" }, { "start_pos": 224, "end_pos": 226, "annotation": "n_glycosylation_sequon" }, { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" }, { "start_pos": 288, "end_pos": 290, "annotation": "n_glycosylation_sequon" }, { "start_pos": 292, "end_pos": 294, "annotation": "n_glycosylation_sequon" }, { "start_pos": 302, "end_pos": 304, "annotation": "n_glycosylation_sequon" }, { "start_pos": 315, "end_pos": 317, "annotation": "n_glycosylation_sequon" }, { "start_pos": 331, "end_pos": 333, "annotation": "n_glycosylation_sequon" }, { "start_pos": 374, "end_pos": 376, "annotation": "n_glycosylation_sequon" }, { "start_pos": 87, "end_pos": 89, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated on serine and threonine.", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "PubMed", "id": "8420979", "url": "https://glygen.org/publication/PubMed/8420979" } ] }, { "annotation": "Phosphorylated on serine and tyrosine (PubMed:8420979). Isoform 1 is phosphorylated on tyrosine by Src family kinases like SRC and LCK and by receptor like CSF3R, EGFR and INSR upon stimulation (PubMed:15467833, PubMed:7626603, PubMed:9712832, PubMed:16054098). Phosphorylated at Ser-503; mediates activity. Phosphorylated at Tyr-488; regulates activity (PubMed:7518458). Phosphorylated at Tyr-488 by EGFR and INSR upon stimulation; this phosphorylation is Ser-503-phosphorylation-dependent; mediates cellular internalization; increases interaction with FASN (PubMed:16054098, PubMed:15467833, PubMed:7626603, PubMed:9712832). Phosphorylated at Tyr-488 and Tyr-513 by LCK; mediates PTPN6 association and is regulated by homophilic ligation of CEACAM1 in the absence of T-cell activation (By similarity). Phosphorylated at Tyr-513; mediates interaction with PTPN11 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P16573", "url": "https://www.uniprot.org/uniprot/P16573" }, { "database": "PubMed", "id": "7626603", "url": "https://glygen.org/publication/PubMed/7626603" }, { "database": "PubMed", "id": "8420979", "url": "https://glygen.org/publication/PubMed/8420979" }, { "database": "PubMed", "id": "P13688", "url": "https://glygen.org/publication/PubMed/P13688" }, { "database": "PubMed", "id": "7518458", "url": "https://glygen.org/publication/PubMed/7518458" }, { "database": "PubMed", "id": "9712832", "url": "https://glygen.org/publication/PubMed/9712832" }, { "database": "PubMed", "id": "16054098", "url": "https://glygen.org/publication/PubMed/16054098" }, { "database": "PubMed", "id": "P31809", "url": "https://glygen.org/publication/PubMed/P31809" }, { "database": "PubMed", "id": "15467833", "url": "https://glygen.org/publication/PubMed/15467833" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 15 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 15 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }