{ "uniprot_canonical_ac": "P15105-1", "uniprot_ac": "P15105", "uniprot_id": "GLNA_MOUSE", "mass": { "chemical_mass": 42120.0, "monoisotopic_mass": 42120.0 }, "refseq": { "ac": "NP_032157", "name": "glutamine synthetase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032157" }, "gene_names": [ { "name": "Glul", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P15105", "id": "P15105" }, { "name": "Glns; GS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032157", "id": "NP_032157" }, { "name": "Glns", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P15105", "id": "P15105" }, { "name": "Glul", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032157", "id": "NP_032157" } ], "protein_names": [ { "name": "Glutamine synthetase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P15105" }, { "name": "2.3.1.225", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P15105" }, { "name": "6.3.1.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P15105" }, { "name": "GS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P15105" }, { "name": "Glutamate--ammonia ligase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P15105" }, { "name": "Palmitoyltransferase GLUL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P15105" }, { "name": "glutamate-ammonia ligase (glutamine synthase); glutamate decarboxylase; palmitoyltransferase GLUL; glutamate-ammonia ligase (glutamine synthetase)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032157", "id": "NP_032157" }, { "name": "glutamine synthetase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032157", "id": "NP_032157" } ], "function": [ { "annotation": "Glutamine synthetase that catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine (By similarity). Its role depends on tissue localization: in the brain, it regulates the levels of toxic ammonia and converts neurotoxic glutamate to harmless glutamine, whereas in the liver, it is one of the enzymes responsible for the removal of ammonia (PubMed:25870278). Essential for proliferation of fetal skin fibroblasts (By similarity). Independently of its glutamine synthetase activity, required for endothelial cell migration during vascular development (PubMed:30158707). Involved in angiogenesis by regulating membrane localization and activation of the GTPase RHOJ, possibly by promoting RHOJ palmitoylation (By similarity). May act as a palmitoyltransferase for RHOJ: able to autopalmitoylate and then transfer the palmitoyl group to RHOJ (By similarity). Plays a role in ribosomal 40S subunit biogenesis (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105#function" }, { "database": "PubMed", "id": "25870278", "url": "https://glygen.org/publication/PubMed/25870278" }, { "database": "PubMed", "id": "30158707", "url": "https://glygen.org/publication/PubMed/30158707" }, { "database": "UniProtKB", "id": "P15104", "url": "https://www.uniprot.org/uniprot/P15104#function" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:11832", "recommended_name": { "id": "DOID:11832", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11832", "name": "visual epilepsy", "description": "" }, "synonyms": [ { "id": "DOID:11832", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11832", "name": "epilepsy, visual", "description": "" } ], "evidence": [ { "id": "11832", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11832" } ] }, { "disease_id": "DOID:12858", "recommended_name": { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington's disease", "description": "A neurodegenerative disease that has_material_basis_in autosomal dominant inheritance and is characterized by unwanted choreatic movements, behavioral and psychiatric disturbances and dementia and has_material_basis_in expansion of CAG triplet repeats (glutamine) resulting in neuron degeneration affecting muscle coordination, cognitive abilities." }, "synonyms": [ { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "HD", "description": "" }, { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington disease", "description": "" }, { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington's chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease", "description": "Huntington disease (HD) is a rare neurodegenerative disorder of the central nervous system characterized by unwanted choreatic movements, behavioral and psychiatric disturbances and dementia." }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "HD", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington's chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington's disease", "description": "" }, { "id": "MIM:143100", "resource": "MIM", "url": "https://www.omim.org/entry/143100", "name": "Huntington disease", "description": "Huntington disease" } ], "evidence": [ { "id": "12858", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12858" } ] }, { "disease_id": "DOID:3328", "recommended_name": { "id": "DOID:3328", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3328", "name": "temporal lobe epilepsy", "description": "A focal epilepsy that is characterized by recurrent, unprovoked focal seizures that originate in the temporal lobe of the brain and last about one or two minutes." }, "synonyms": [ { "id": "DOID:3328", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3328", "name": "epilepsy, temporal lobe", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, familial temporal lobe, 1", "description": "An autosomal dominant condition caused by mutation(s) in the LGI1 gene, encoding leucine-rich glioma-inactivated protein 1. It is characterized by partial seizures originating in the temporal lobe and often accompanied by auditory sensory manifestations." }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "ETL1", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, familial temporal lobe, type 1", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, lateral temporal lobe, autosomal dominant", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, partial, with auditory features", "description": "" }, { "id": "MIM:600512", "resource": "MIM", "url": "https://www.omim.org/entry/600512", "name": "Epilepsy, familial temporal lobe, 1", "description": "Epilepsy, familial temporal lobe, 1" } ], "evidence": [ { "id": "3328", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3328" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [ { "evidence": [ { "id": "rs3388504640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388504640" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 310, "end_pos": 310, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIN->NIS).", "chr_id": "1", "chr_pos": "153783735", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N310", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Glul", "url": "https://www.uniprot.org/uniprot/P15105", "locus": { "chromosome": "1", "start_pos": 153785469, "end_pos": 153775690, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000026473", "url": "https://www.ensembl.org/id/ENSMUSG00000026473" } ] } } ], "crossref": [ { "id": "ENSMUSG00000026473", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000026473", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "6.3.1.2", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=6.3.1.2&UniProtAcc=P15105", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "14645", "url": "https://www.ncbi.nlm.nih.gov/gene/14645", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P15105", "url": "https://www.ebi.ac.uk/intact/interactors/id:P15105*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008146", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008146", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008147", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008147", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014746", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014746", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027302", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027302", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027303", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027303", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036651", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036651", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:14645", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14645", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "95739", "url": "http://www.informatics.jax.org/marker/MGI:95739", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P15105", "url": "https://oglcnac.org/atlas/detail/P15105", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P15105", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P15105", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DRRPNAN", "url": "https://omabrowser.org/oma/group/DRRPNAN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1115057at2759", "url": "http://www.orthodb.org/?query=1115057at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR20852", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20852", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20852:SF45", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20852:SF45", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00120", "url": "http://pfam.xfam.org/family/PF00120", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03951", "url": "http://pfam.xfam.org/family/PF03951", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P15105", "url": "http://purl.obolibrary.org/obo/PR_P15105", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-210455", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-210455", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8964539", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8964539", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_032157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032157", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16169", "url": "https://www.rhea-db.org/rhea/16169", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36683", "url": "https://www.rhea-db.org/rhea/36683", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "D3YVK1", "url": "https://www.uniprot.org/uniprot/D3YVK1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YVK1-1", "url": "https://www.uniprot.org/uniprot/D3YVK1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P15105-1", "url": "https://www.uniprot.org/uniprot/P15105-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNETGDEPFQYKN", "length": 373, "header": "sp|P15105-1|GLNA_MOUSE Isoform 1 of Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 CANONICAL=P15105-1" }, "isoforms": [ { "isoform_ac": "D3YVK1-1", "url": "", "sequence": { "sequence": "MATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVM", "length": 198, "header": "tr|D3YVK1-1|D3YVK1_MOUSE Computationally mapped isoform of Palmitoyltransferase GLUL OS=Mus musculus OX=10090 GN=Glul PE=1 SV=8 CANONICAL=P15105-1" }, "locus": { "chromosome": "1", "start_pos": 153782884, "end_pos": 153778693, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000139476.8", "url": "https://www.ensembl.org/id/ENSMUST00000139476.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114377.2", "url": "https://www.ensembl.org/id/ENSMUSP00000114377.2" } ] } }, { "isoform_ac": "P15105-1", "url": "", "sequence": { "sequence": "MATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNETGDEPFQYKN", "length": 373, "header": "sp|P15105-1|GLNA_MOUSE Isoform 1 of Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 CANONICAL=P15105-1" }, "locus": { "chromosome": "1", "start_pos": 153783925, "end_pos": 153778693, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000086199", "url": "https://www.ensembl.org/id/ENSMUST00000086199" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000083375", "url": "https://www.ensembl.org/id/ENSMUSP00000083375" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 142, "start_aa": "Thr", "end_pos": 142, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr142", "evidence": [ { "id": "P15105", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P15105" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" }, { "id": "36031420", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36031420" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 258, "start_aa": "Thr", "end_pos": 258, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr258", "evidence": [ { "id": "P15105", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P15105" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" } ] } ], "phosphorylation": [ { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" }, { "database": "PubMed", "id": "18034455", "url": "https://glygen.org/publication/PubMed/18034455" }, { "database": "iPTMnet", "id": "P15105", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15105" } ], "site_lbl": "Tyr104" }, { "start_pos": 301, "end_pos": 301, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15105", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15105" }, { "database": "PubMed", "id": "31178690", "url": "https://glygen.org/publication/PubMed/31178690" } ], "site_lbl": "Thr301" }, { "start_pos": 343, "end_pos": 343, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P15105", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15105" }, { "database": "PubMed", "id": "31178690", "url": "https://glygen.org/publication/PubMed/31178690" } ], "site_lbl": "Ser343" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Molecular characterization and immunohistochemical localization of palmdelphin, a cytosolic isoform of the paralemmin protein family implicated in membrane dynamics.", "journal": "Eur. J. Cell Biol.", "date": "2005", "authors": "Hu B, Petrasch-Parwez E, Laue MM, Kilimann MW", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "reference": [ { "type": "PubMed", "id": "16323283", "url": "https://glygen.org/publication/PubMed/16323283" } ] }, { "title": "Glutamine synthetase is essential in early mouse embryogenesis.", "journal": "Dev. Dyn.", "date": "2007", "authors": "He Y., Lamers W.H., Hakvoort T.B., Van Roon M.A., Vermeulen J.L.", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "reference": [ { "type": "PubMed", "id": "17557305", "url": "https://glygen.org/publication/PubMed/17557305" } ] }, { "title": "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ballif BA, Carey GR, Sunyaev SR, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" }, { "database": "UniProtKB", "id": "D3YVK1", "url": "https://www.uniprot.org/uniprot/D3YVK1" }, { "database": "iPTMnet", "id": "P15105", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15105" } ], "reference": [ { "type": "PubMed", "id": "18034455", "url": "https://glygen.org/publication/PubMed/18034455" } ] }, { "title": "Proteasomal degradation of glutamine synthetase regulates schwann cell differentiation.", "journal": "J. Neurosci.", "date": "2010", "authors": "Saitoh F, Araki T", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "reference": [ { "type": "PubMed", "id": "20107048", "url": "https://glygen.org/publication/PubMed/20107048" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" }, { "database": "iPTMnet", "id": "P15105", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15105" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Database", "id": "P15105", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P15105" }, { "database": "O-GlcNAc Atlas", "id": "P15105", "url": "https://oglcnac.org/atlas/detail/P15105" } ], "reference": [ { "type": "PubMed", "id": "22645316", "url": "https://glygen.org/publication/PubMed/22645316" } ] }, { "title": "Mouse glutamine synthetase is encoded by a single gene that can be expressed in a localized fashion.", "journal": "J. Mol. Biol.", "date": "1989", "authors": "Darnell J.E. Jr., Kuo C.F.", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "reference": [ { "type": "PubMed", "id": "2475638", "url": "https://glygen.org/publication/PubMed/2475638" } ] }, { "title": "Hyperammonemia in gene-targeted mice lacking functional hepatic glutamine synthetase.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2015", "authors": "Lang F., Pozdeev V.I., Goerg B., Haeussinger D., Bode J.G., Herebian D., Lang P.A., Lang E., Lang K.S., Bidmon H.J., Leibrock C.B., Ortiz M.P., Qvartskhava N.", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "reference": [ { "type": "PubMed", "id": "25870278", "url": "https://glygen.org/publication/PubMed/25870278" } ] }, { "title": "Role of glutamine synthetase in angiogenesis beyond glutamine synthesis.", "journal": "Nature", "date": "2018", "authors": "Eelen G, Dubois C, Cantelmo AR, Goveia J, Bruning U, DeRan M, Jarugumilli G, van Rijssel J, Saladino G, Comitani F, Zecchin A, Rocha S, Chen R, Huang H, Vandekeere S, Kalucka J, Lange C, Morales-Rodriguez F, Cruys B, Treps L, Ramer L, Vinckier S, Brepoels K, Wyns S, Souffreau J, Schoonjans L, Lamers WH, Wu Y, Haustraete J, Hofkens J, Liekens S, Cubbon R, Ghesquiere B, Dewerchin M, Gervasio FL, Li X, van Buul JD, Wu X, Carmeliet P", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "reference": [ { "type": "PubMed", "id": "30158707", "url": "https://glygen.org/publication/PubMed/30158707" } ] }, { "title": "Phosphorylation of Glutamine Synthetase on Threonine 301 Contributes to Its Inactivation During Epilepsy.", "journal": "Frontiers in molecular neuroscience", "date": "2019", "authors": "Huyghe D, Denninger AR, Voss CM, Frank P, Gao N, Brandon N, Waagepetersen HS, Ferguson AD, Pangalos M, Doig P, Moss SJ", "evidence": [ { "database": "iPTMnet", "id": "P15105", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15105" } ], "reference": [ { "type": "PubMed", "id": "31178690", "url": "https://glygen.org/publication/PubMed/31178690" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P15105", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P15105" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "Hypoxia-triggered O-GlcNAcylation in the brain drives the glutamate-glutamine cycle and reduces sensitivity to sevoflurane in mice.", "journal": "British journal of anaesthesia", "date": "2022-11", "authors": "He Qin-Qin, Yang Man, Huang Jing, Wu Wei, Tang Kuo, Zhang Yong, Zhou Jian, Ou Wei, Xie Maodi, Liang Yu, Lu Peilin, Zuo Yunxia, Yu Hai, Li Tao", "evidence": [ { "database": "O-GlcNAc Database", "id": "P15105", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P15105" } ], "reference": [ { "type": "PubMed", "id": "36031420", "url": "https://glygen.org/publication/PubMed/36031420" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P15105", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P15105" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "pathway": [ { "id": "mmu:14645", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14645", "resource": "KEGG Pathway" }, { "id": "R-MMU-210455", "name": "Astrocytic Glutamate-Glutamine Uptake And Metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-210455", "resource": "Reactome", "description": "Astrocytic Glutamate-Glutamine Uptake And Metabolism" }, { "id": "R-MMU-8964539", "name": "Glutamate and glutamine metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8964539", "resource": "Reactome", "description": "Glutamate and glutamine metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P09606-1", "protein_name": "Glutamine synthetase", "gene_name": "Glul", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MATSASSHLNKGIKQMYMNLPQGEKIQLMYIWVDGTGEGLRCKTRTLDCDPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRRDPNKLVFCEVFKYNRKPAETNLRHSCKRIMDMVSSQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLRCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRIVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNETGDEPFQYKN", "length": 373 }, "evidence": [ { "id": "45225355", "url": "http://www.informatics.jax.org/homology/45225355", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P15104-1", "protein_name": "Glutamine synthetase", "gene_name": "GLUL", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN", "length": 373 }, "evidence": [ { "id": "45225355", "url": "http://www.informatics.jax.org/homology/45225355", "database": "MGI" }, { "id": "P15105", "url": "https://omabrowser.org/oma/group/P15105/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P20478-1", "protein_name": "Glutamine synthetase 2 cytoplasmic", "gene_name": "Gs2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSARILEDSPNARINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE", "length": 369 }, "evidence": [ { "id": "P15105", "url": "https://omabrowser.org/oma/group/P15105/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P32288-1", "protein_name": "Glutamine synthetase", "gene_name": "GLN1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MAEASIEKTQILQKYLELDQRGRIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFDGSSTNQAPGHDSDIYLKPVAYYPDPFRRGDNIVVLAACYNNDGTPNKFNHRHEAAKLFAAHKDEEIWFGLEQEYTLFDMYDDVYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRACLYAGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFLHRVAEEFGIKISFHPKPLKGDWNGAGCHTNVSTKEMRQPGGMKYIEQAIEKLSKRHAEHIKLYGSDNDMRLTGRHETASMTAFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPASNIDPYLVTGIMCETVCGAIDNADMTKEFERESS", "length": 370 }, "evidence": [ { "id": "P15105", "url": "https://omabrowser.org/oma/group/P15105/", "database": "OMA" } ], "common_name": "Yeast" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "manganese ion binding", "id": "GO:0030145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030145", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "protein-cysteine S-palmitoyltransferase activity", "id": "GO:0019706", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019706", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "glutamate-ammonia ligase activity", "id": "GO:0004356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004356", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "dynein light chain binding", "id": "GO:0045503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045503", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "glutamate binding", "id": "GO:0016595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016595", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "glutamate metabolic process", "id": "GO:0006536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006536", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "cell population proliferation", "id": "GO:0008283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008283", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "positive regulation of insulin secretion", "id": "GO:0032024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032024", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "positive regulation of synaptic transmission, glutamatergic", "id": "GO:0051968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051968", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "ribosome biogenesis", "id": "GO:0042254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042254", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "response to glucose", "id": "GO:0009749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009749", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "cellular response to starvation", "id": "GO:0009267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009267", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "positive regulation of epithelial cell proliferation", "id": "GO:0050679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050679", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "ammonia assimilation cycle", "id": "GO:0019676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019676", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "regulation of sprouting angiogenesis", "id": "GO:1903670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903670", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "glutamine biosynthetic process", "id": "GO:0006542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006542", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "regulation of endothelial cell migration", "id": "GO:0010594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010594", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "protein palmitoylation", "id": "GO:0018345", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018345", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "regulation of protein localization to nucleolus", "id": "GO:1904749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904749", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "myelin sheath", "id": "GO:0043209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043209", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "axon terminus", "id": "GO:0043679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043679", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "cell body", "id": "GO:0044297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044297", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "cell projection", "id": "GO:0042995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042995", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "glial cell projection", "id": "GO:0097386", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097386", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 255, "end_pos": 257, "annotation": "n_glycosylation_sequon" }, { "start_pos": 362, "end_pos": 364, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Palmitoylated; undergoes autopalmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" }, { "database": "PubMed", "id": "P15104", "url": "https://glygen.org/publication/PubMed/P15104" } ] }, { "annotation": "Ubiquitinated by ZNRF1.", "evidence": [ { "database": "UniProtKB", "id": "P15105", "url": "https://www.uniprot.org/uniprot/P15105" }, { "database": "PubMed", "id": "20107048", "url": "https://glygen.org/publication/PubMed/20107048" } ] } ], "interactions": [], "reactions": [ { "id": "16169", "name": "", "equation": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P09606-1", "P15104-1", "P15105-1", "P32288-1", "P0C7B6-1", "Q54WR9-1", "Q86B00-1", "P20477-1", "P20478-1" ], "evidence": [ { "id": "16169", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16169" } ] }, { "id": "36683", "name": "", "equation": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P09606-1", "Q2TGI8-1", "Q2TGJ1-1", "Q2TGJ4-1", "Q2THW7-1", "Q2TGI5-1", "Q5FVR1-1", "E9PTT0-1", "Q2THW6-1", "Q32PY5-1", "Q6DGF5-1", "Q2TGK3-1", "Q76IC6-1", "Q923G5-1", "Q9JKR5-1", "A0A8I6AR22-1", "A0A8I6ALH7-1", "Q2TGJ5-1", "A0A8I6G4A8-1", "E9PU37-1", "Q2TGJ0-1", "Q2TGI4-1", "F7F533-1", "F7F2Z1-1", "A0A8I6G292-1", "A6J842-1", "Q8WTX9-1", "Q9NXF8-1", "Q9ULC8-1", "Q9Y397-1", "Q9H8X9-1", "Q8IZN3-1", "Q9NUE0-1", "Q6UX98-1", "Q9C0B5-1", "Q9H6R6-1", "Q96GR4-1", "Q9UIJ5-1", "Q8IYP9-1", "Q969W1-1", "P15104-1", "Q96MV8-1", "Q8IUH5-1", "Q5W0Z9-1", "Q9NPG8-1", "Q9NYG2-1", "Q8IUH4-1", "P0C7U3-1", "Q8WVZ1-1", "Q8IVQ6-1", "Q8N966-1", "Q9ESG8-1", "P15105-1", "P59267-1", "Q91WU6-1", "Q8VC90-1", "Q8VDZ4-1", "Q810M4-1", "Q8R0N9-1", "Q8R173-1", "Q8BQQ1-1", "Q810M5-1", "Q5Y5T3-1", "Q80TN5-1", "Q8BGJ0-1", "A0PK84-1", "Q6IR37-1", "Q9D270-1", "P59268-1", "Q9D6H5-1", "Q14AK4-1", "Q5Y5T5-1", "Q5Y5T1-1", "Q5Y5T2-1", "Q9CPV7-1", "Q9CWU2-1", "P39010-1", "P42836-1", "Q04629-1", "Q06551-1", "Q12006-1", "Q03289-1", "Q12013-1", "Q54JY9-1", "Q54PF0-1", "Q54RL6-1", "Q54X19-1", "Q54YH2-1", "Q555N7-1", "Q54B34-1", "Q54VH7-1", "Q550R7-1", "Q552M6-1", "Q554E7-1", "Q557H5-1", "Q86A83-1", "Q8T2Q0-1", "Q9VUW9-1", "Q9W345-1", "A2VEY9-1", "Q9VBM6-1", "A0A4D6K4L3-1", "A0A0B4LF16-1", "A1ZAR2-1", "Q9W251-1", "Q8IQN9-1", "Q7K3T4-1", "Q9VQK9-1", "Q9VBM5-1", "Q9VSV3-1", "Q9VBM4-1", "Q9VG80-1", "Q9I7L7-1", "Q9VBM8-1", "Q9VKN8-1", "Q9VB73-1", "Q0IGS7-1", "Q9VBM7-1" ], "evidence": [ { "id": "36683", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36683" } ] }, { "id": "R-MMU-70606", "name": "glutamate + NH4+ + ATP => glutamine + ADP + orthophosphate [GLUL]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-29472" ], "enzyme_list": [ "P15105-1" ], "evidence": [ { "id": "R-MMU-70606", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70606" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-29472", "participant_name": "L-Gln [cytosol]", "crossref": [ { "id": "C00064", "database": "COMPOUND", "url": "" }, { "id": "58359", "database": "ChEBI", "url": "" }, { "id": "000001532526", "database": "ZINC", "url": "" }, { "id": "000001532526", "database": "ZINC", "url": "" }, { "id": "C00064", "database": "COMPOUND", "url": "" }, { "id": "58359", "database": "ChEBI", "url": "" }, { "id": "C00064", "database": "COMPOUND", "url": "" }, { "id": "58359", "database": "ChEBI", "url": "" }, { "id": "000001532526", "database": "ZINC", "url": "" }, { "id": "C00064", "database": "COMPOUND", "url": "" }, { "id": "58359", "database": "ChEBI", "url": "" }, { "id": "000001532526", "database": "ZINC", "url": "" }, { "id": "C00064", "database": "COMPOUND", "url": "" }, { "id": "58359", "database": "ChEBI", "url": "" }, { "id": "000001532526", "database": "ZINC", "url": "" }, { "id": "C00064", "database": "COMPOUND", "url": "" }, { "id": "58359", "database": "ChEBI", "url": "" }, { "id": "000001532526", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4LF16", "gene_name": "Dmel\\CG1407", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A0A0B4LF16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4LF16" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A0A0B4LF16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4LF16" } ] } ] }, { "uniprot_ac": "A0A4D6K4L3", "gene_name": "Patsas", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A0A4D6K4L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4D6K4L3" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A0A4D6K4L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4D6K4L3" } ] } ] }, { "uniprot_ac": "A0A8I6ALH7", "gene_name": "Zdhhc11", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A0A8I6ALH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ALH7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A0A8I6ALH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ALH7" } ] } ] }, { "uniprot_ac": "A0A8I6AR22", "gene_name": "Zdhhc20", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A0A8I6AR22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AR22" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A0A8I6AR22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AR22" } ] } ] }, { "uniprot_ac": "A0A8I6G292", "gene_name": "ENSRNOG00000067753", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A0A8I6G292", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G292" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A0A8I6G292", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G292" } ] } ] }, { "uniprot_ac": "A0A8I6G4A8", "gene_name": "Zdhhc16", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A0A8I6G4A8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G4A8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A0A8I6G4A8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G4A8" } ] } ] }, { "uniprot_ac": "A0PK84", "gene_name": "Zdhhc22", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A0PK84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0PK84" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A0PK84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0PK84" } ] } ] }, { "uniprot_ac": "A1ZAR2", "gene_name": "Dmel\\CG17287", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A1ZAR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZAR2" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A1ZAR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZAR2" } ] } ] }, { "uniprot_ac": "A2VEY9", "gene_name": "app", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A2VEY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2VEY9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A2VEY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2VEY9" } ] } ] }, { "uniprot_ac": "A6J842", "gene_name": "Zdhhc21", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "A6J842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6J842" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "A6J842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6J842" } ] } ] }, { "uniprot_ac": "E9PTT0", "gene_name": "Zdhhc17", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "E9PTT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTT0" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "E9PTT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTT0" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "E9PTT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTT0" } ] } ] }, { "uniprot_ac": "E9PU37", "gene_name": "Zdhhc13", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "E9PU37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PU37" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "E9PU37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PU37" } ] } ] }, { "uniprot_ac": "F7F2Z1", "gene_name": "Zdhhc1", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "F7F2Z1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F2Z1" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "F7F2Z1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F2Z1" } ] } ] }, { "uniprot_ac": "F7F533", "gene_name": "Zdhhc9", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "F7F533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F533" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "F7F533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F533" } ] } ] }, { "uniprot_ac": "P09606", "gene_name": "Glul", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "P09606", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09606" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "P09606", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09606" } ] }, { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P09606", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09606" } ] } ] }, { "uniprot_ac": "P0C7B6", "gene_name": "glnA2", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "P0C7B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C7B6" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "P0C7B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C7B6" } ] } ] }, { "uniprot_ac": "P0C7U3", "gene_name": "ZDHHC11B", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P0C7U3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C7U3" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "P0C7U3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C7U3" } ] } ] }, { "uniprot_ac": "P15104", "gene_name": "GLUL", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "P15104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15104" } ] }, { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P15104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15104" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "P15104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15104" } ] } ] }, { "uniprot_ac": "P15105", "gene_name": "Glul", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "P15105", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15105" } ] }, { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P15105", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15105" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "P15105", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15105" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "P15105", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15105" } ] } ] }, { "uniprot_ac": "P20477", "gene_name": "Gs1", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "P20477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20477" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "P20477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20477" } ] } ] }, { "uniprot_ac": "P20478", "gene_name": "Gs2", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "P20478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20478" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "P20478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20478" } ] } ] }, { "uniprot_ac": "P32288", "gene_name": "GLN1", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "P32288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32288" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "P32288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32288" } ] } ] }, { "uniprot_ac": "P39010", "gene_name": "AKR1", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P39010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39010" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "P39010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39010" } ] } ] }, { "uniprot_ac": "P42836", "gene_name": "PFA3", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P42836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42836" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "P42836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42836" } ] } ] }, { "uniprot_ac": "P59267", "gene_name": "Zdhhc2", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P59267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59267" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "P59267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59267" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "P59267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59267" } ] } ] }, { "uniprot_ac": "P59268", "gene_name": "Zdhhc9", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P59268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59268" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "P59268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59268" } ] } ] }, { "uniprot_ac": "Q03289", "gene_name": "PFA5", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q03289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03289" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q03289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03289" } ] } ] }, { "uniprot_ac": "Q04629", "gene_name": "SWF1", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q04629", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04629" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q04629", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04629" } ] } ] }, { "uniprot_ac": "Q06551", "gene_name": "ERF2", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q06551", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06551" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q06551", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06551" } ] } ] }, { "uniprot_ac": "Q0IGS7", "gene_name": "Dmel\\CG4676", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q0IGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0IGS7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q0IGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0IGS7" } ] } ] }, { "uniprot_ac": "Q12006", "gene_name": "PFA4", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q12006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12006" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q12006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12006" } ] } ] }, { "uniprot_ac": "Q12013", "gene_name": "AKR2", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q12013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12013" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q12013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12013" } ] } ] }, { "uniprot_ac": "Q14AK4", "gene_name": "Zdhhc11", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q14AK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14AK4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q14AK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14AK4" } ] } ] }, { "uniprot_ac": "Q2TGI4", "gene_name": "Zdhhc25", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2TGI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGI4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2TGI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGI4" } ] } ] }, { "uniprot_ac": "Q2TGI5", "gene_name": "Zdhhc24", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2TGI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGI5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2TGI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGI5" } ] } ] }, { "uniprot_ac": "Q2TGI8", "gene_name": "Zdhhc22", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2TGI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGI8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2TGI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGI8" } ] } ] }, { "uniprot_ac": "Q2TGJ0", "gene_name": "Zdhhc19", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2TGJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ0" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2TGJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ0" } ] } ] }, { "uniprot_ac": "Q2TGJ1", "gene_name": "Zdhhc18", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2TGJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ1" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2TGJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ1" } ] } ] }, { "uniprot_ac": "Q2TGJ4", "gene_name": "Zdhhc15", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2TGJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ4" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q2TGJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2TGJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ4" } ] } ] }, { "uniprot_ac": "Q2TGJ5", "gene_name": "Zdhhc14", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2TGJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2TGJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGJ5" } ] } ] }, { "uniprot_ac": "Q2TGK3", "gene_name": "Zdhhc3", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2TGK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGK3" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2TGK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGK3" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q2TGK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TGK3" } ] } ] }, { "uniprot_ac": "Q2THW6", "gene_name": "Zdhhc8", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2THW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2THW6" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2THW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2THW6" } ] } ] }, { "uniprot_ac": "Q2THW7", "gene_name": "Zdhhc5", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q2THW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2THW7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q2THW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2THW7" } ] } ] }, { "uniprot_ac": "Q32PY5", "gene_name": "Zdhhc6", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q32PY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32PY5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q32PY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32PY5" } ] } ] }, { "uniprot_ac": "Q54B34", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q54B34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B34" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q54B34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B34" } ] } ] }, { "uniprot_ac": "Q54JY9", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q54JY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JY9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q54JY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JY9" } ] } ] }, { "uniprot_ac": "Q54PF0", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q54PF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54PF0" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q54PF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54PF0" } ] } ] }, { "uniprot_ac": "Q54RL6", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q54RL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RL6" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q54RL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RL6" } ] } ] }, { "uniprot_ac": "Q54VH7", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q54VH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VH7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q54VH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VH7" } ] } ] }, { "uniprot_ac": "Q54WR9", "gene_name": "glnA3", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "Q54WR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WR9" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "Q54WR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WR9" } ] } ] }, { "uniprot_ac": "Q54X19", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q54X19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54X19" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q54X19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54X19" } ] } ] }, { "uniprot_ac": "Q54YH2", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q54YH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YH2" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q54YH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YH2" } ] } ] }, { "uniprot_ac": "Q550R7", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q550R7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q550R7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q550R7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q550R7" } ] } ] }, { "uniprot_ac": "Q552M6", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q552M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552M6" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q552M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552M6" } ] } ] }, { "uniprot_ac": "Q554E7", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q554E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q554E7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q554E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q554E7" } ] } ] }, { "uniprot_ac": "Q555N7", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q555N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555N7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q555N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555N7" } ] } ] }, { "uniprot_ac": "Q557H5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q557H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q557H5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q557H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q557H5" } ] } ] }, { "uniprot_ac": "Q5FVR1", "gene_name": "Zdhhc4", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q5FVR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVR1" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q5FVR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVR1" } ] } ] }, { "uniprot_ac": "Q5W0Z9", "gene_name": "ZDHHC20", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q5W0Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5W0Z9" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q5W0Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5W0Z9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q5W0Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5W0Z9" } ] } ] }, { "uniprot_ac": "Q5Y5T1", "gene_name": "Zdhhc20", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q5Y5T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T1" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q5Y5T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T1" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q5Y5T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T1" } ] } ] }, { "uniprot_ac": "Q5Y5T2", "gene_name": "Zdhhc18", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q5Y5T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T2" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q5Y5T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T2" } ] } ] }, { "uniprot_ac": "Q5Y5T3", "gene_name": "Zdhhc23", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q5Y5T3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T3" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q5Y5T3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T3" } ] } ] }, { "uniprot_ac": "Q5Y5T5", "gene_name": "Zdhhc8", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q5Y5T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q5Y5T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5Y5T5" } ] } ] }, { "uniprot_ac": "Q6DGF5", "gene_name": "Zdhhc12", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q6DGF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6DGF5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q6DGF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6DGF5" } ] } ] }, { "uniprot_ac": "Q6IR37", "gene_name": "Zdhhc24", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q6IR37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IR37" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q6IR37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IR37" } ] } ] }, { "uniprot_ac": "Q6UX98", "gene_name": "ZDHHC24", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q6UX98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UX98" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q6UX98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UX98" } ] } ] }, { "uniprot_ac": "Q76IC6", "gene_name": "Zdhhc23", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q76IC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76IC6" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q76IC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76IC6" } ] } ] }, { "uniprot_ac": "Q7K3T4", "gene_name": "anon-WO0118547.93", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q7K3T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K3T4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q7K3T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K3T4" } ] } ] }, { "uniprot_ac": "Q80TN5", "gene_name": "Zdhhc17", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q80TN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80TN5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q80TN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80TN5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q80TN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80TN5" } ] } ] }, { "uniprot_ac": "Q810M4", "gene_name": "Zdhhc25", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q810M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810M4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q810M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810M4" } ] } ] }, { "uniprot_ac": "Q810M5", "gene_name": "Zdhhc19", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q810M5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810M5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q810M5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810M5" } ] } ] }, { "uniprot_ac": "Q86A83", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q86A83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86A83" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q86A83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86A83" } ] } ] }, { "uniprot_ac": "Q86B00", "gene_name": "glnA1", "activity": [ { "ec_number": "6.3.1.2", "activity": "ATP + L-glutamate + NH4(+) = ADP + H(+) + L-glutamine + phosphate.", "evidence": [ { "id": "Q86B00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86B00" } ] }, { "ec_number": "6.3.1.2", "activity": "", "evidence": [ { "id": "Q86B00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86B00" } ] } ] }, { "uniprot_ac": "Q8BGJ0", "gene_name": "Zdhhc15", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8BGJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGJ0" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8BGJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGJ0" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8BGJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGJ0" } ] } ] }, { "uniprot_ac": "Q8BQQ1", "gene_name": "Zdhhc14", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8BQQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BQQ1" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8BQQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BQQ1" } ] } ] }, { "uniprot_ac": "Q8IQN9", "gene_name": "Dmel\\CG13029", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8IQN9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IQN9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8IQN9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IQN9" } ] } ] }, { "uniprot_ac": "Q8IUH4", "gene_name": "ZDHHC13", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8IUH4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUH4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8IUH4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUH4" } ] } ] }, { "uniprot_ac": "Q8IUH5", "gene_name": "ZDHHC17", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8IUH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUH5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8IUH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUH5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8IUH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUH5" } ] } ] }, { "uniprot_ac": "Q8IVQ6", "gene_name": "ZDHHC21", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8IVQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVQ6" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8IVQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVQ6" } ] } ] }, { "uniprot_ac": "Q8IYP9", "gene_name": "ZDHHC23", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8IYP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYP9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8IYP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYP9" } ] } ] }, { "uniprot_ac": "Q8IZN3", "gene_name": "ZDHHC14", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8IZN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IZN3" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8IZN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IZN3" } ] } ] }, { "uniprot_ac": "Q8N966", "gene_name": "ZDHHC22", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8N966", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N966" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8N966", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N966" } ] } ] }, { "uniprot_ac": "Q8R0N9", "gene_name": "Zdhhc1", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8R0N9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0N9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8R0N9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0N9" } ] } ] }, { "uniprot_ac": "Q8R173", "gene_name": "Zdhhc3", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8R173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R173" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8R173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R173" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8R173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R173" } ] } ] }, { "uniprot_ac": "Q8T2Q0", "gene_name": "", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8T2Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T2Q0" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8T2Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T2Q0" } ] } ] }, { "uniprot_ac": "Q8VC90", "gene_name": "Zdhhc12", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8VC90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VC90" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8VC90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VC90" } ] } ] }, { "uniprot_ac": "Q8VDZ4", "gene_name": "Zdhhc5", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8VDZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDZ4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8VDZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDZ4" } ] } ] }, { "uniprot_ac": "Q8WTX9", "gene_name": "ZDHHC1", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8WTX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTX9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8WTX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTX9" } ] } ] }, { "uniprot_ac": "Q8WVZ1", "gene_name": "ZDHHC19", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q8WVZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVZ1" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q8WVZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVZ1" } ] } ] }, { "uniprot_ac": "Q91WU6", "gene_name": "Zdhhc7", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q91WU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WU6" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q91WU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WU6" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q91WU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WU6" } ] } ] }, { "uniprot_ac": "Q923G5", "gene_name": "Zdhhc7", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q923G5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923G5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q923G5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923G5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q923G5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923G5" } ] } ] }, { "uniprot_ac": "Q969W1", "gene_name": "ZDHHC16", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q969W1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969W1" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q969W1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969W1" } ] } ] }, { "uniprot_ac": "Q96GR4", "gene_name": "ZDHHC12", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q96GR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96GR4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q96GR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96GR4" } ] } ] }, { "uniprot_ac": "Q96MV8", "gene_name": "ZDHHC15", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q96MV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MV8" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q96MV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MV8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q96MV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MV8" } ] } ] }, { "uniprot_ac": "Q9C0B5", "gene_name": "ZDHHC5", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9C0B5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C0B5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9C0B5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C0B5" } ] } ] }, { "uniprot_ac": "Q9CPV7", "gene_name": "Zdhhc6", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9CPV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPV7" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9CPV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPV7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9CPV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPV7" } ] } ] }, { "uniprot_ac": "Q9CWU2", "gene_name": "Zdhhc13", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9CWU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWU2" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9CWU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWU2" } ] } ] }, { "uniprot_ac": "Q9D270", "gene_name": "Zdhhc21", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9D270", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D270" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9D270", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D270" } ] } ] }, { "uniprot_ac": "Q9D6H5", "gene_name": "Zdhhc4", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9D6H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D6H5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9D6H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D6H5" } ] } ] }, { "uniprot_ac": "Q9ESG8", "gene_name": "Zdhhc16", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9ESG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESG8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9ESG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESG8" } ] } ] }, { "uniprot_ac": "Q9H6R6", "gene_name": "ZDHHC6", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9H6R6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6R6" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9H6R6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6R6" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9H6R6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6R6" } ] } ] }, { "uniprot_ac": "Q9H8X9", "gene_name": "ZDHHC11", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9H8X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H8X9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9H8X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H8X9" } ] } ] }, { "uniprot_ac": "Q9I7L7", "gene_name": "Dmel\\CG18810", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9I7L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7L7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9I7L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7L7" } ] } ] }, { "uniprot_ac": "Q9JKR5", "gene_name": "Zdhhc2", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9JKR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JKR5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9JKR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JKR5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9JKR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JKR5" } ] } ] }, { "uniprot_ac": "Q9NPG8", "gene_name": "ZDHHC4", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9NPG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPG8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9NPG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPG8" } ] } ] }, { "uniprot_ac": "Q9NUE0", "gene_name": "ZDHHC18", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9NUE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUE0" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9NUE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUE0" } ] } ] }, { "uniprot_ac": "Q9NXF8", "gene_name": "ZDHHC7", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9NXF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXF8" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9NXF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXF8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9NXF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXF8" } ] } ] }, { "uniprot_ac": "Q9NYG2", "gene_name": "ZDHHC3", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9NYG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYG2" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9NYG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYG2" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9NYG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYG2" } ] } ] }, { "uniprot_ac": "Q9UIJ5", "gene_name": "ZDHHC2", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9UIJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIJ5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9UIJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIJ5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9UIJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIJ5" } ] } ] }, { "uniprot_ac": "Q9ULC8", "gene_name": "ZDHHC8", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9ULC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ULC8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9ULC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ULC8" } ] } ] }, { "uniprot_ac": "Q9VB73", "gene_name": "Dmel\\CG5880", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VB73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VB73" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VB73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VB73" } ] } ] }, { "uniprot_ac": "Q9VBM4", "gene_name": "Dmel\\CG4956", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VBM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM4" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VBM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM4" } ] } ] }, { "uniprot_ac": "Q9VBM5", "gene_name": "CG17195-PA", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VBM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM5" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VBM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM5" } ] } ] }, { "uniprot_ac": "Q9VBM6", "gene_name": "CG17196-PA", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VBM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM6" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VBM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM6" } ] } ] }, { "uniprot_ac": "Q9VBM7", "gene_name": "Dmel\\CG17197", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VBM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM7" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VBM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM7" } ] } ] }, { "uniprot_ac": "Q9VBM8", "gene_name": "Dmel\\CG17198", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VBM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VBM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBM8" } ] } ] }, { "uniprot_ac": "Q9VG80", "gene_name": "Dmel\\CG5196", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VG80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG80" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VG80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG80" } ] } ] }, { "uniprot_ac": "Q9VKN8", "gene_name": "Dnz1", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VKN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VKN8" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VKN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VKN8" } ] } ] }, { "uniprot_ac": "Q9VQK9", "gene_name": "GABPI", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VQK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQK9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VQK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQK9" } ] } ] }, { "uniprot_ac": "Q9VSV3", "gene_name": "Dmel\\CG4483", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VSV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSV3" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VSV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSV3" } ] } ] }, { "uniprot_ac": "Q9VUW9", "gene_name": "Hip14", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9VUW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW9" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9VUW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW9" } ] } ] }, { "uniprot_ac": "Q9W251", "gene_name": "Dmel\\CG10344", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9W251", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W251" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9W251", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W251" } ] } ] }, { "uniprot_ac": "Q9W345", "gene_name": "Zdhhc8", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9W345", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W345" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9W345", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W345" } ] } ] }, { "uniprot_ac": "Q9Y397", "gene_name": "ZDHHC9", "activity": [ { "ec_number": "2.3.1.225", "activity": "hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q9Y397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y397" } ] }, { "ec_number": "2.3.1.225", "activity": "", "evidence": [ { "id": "Q9Y397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y397" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }