{ "uniprot_canonical_ac": "P13130-1", "uniprot_ac": "P13130", "uniprot_id": "SS100_YEAST", "mass": { "chemical_mass": 34226.0, "monoisotopic_mass": 34226.0 }, "refseq": { "ac": "NP_012007", "name": "Sps100p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012007" }, "gene_names": [ { "name": "SPS100", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13130", "id": "P13130" }, { "name": "SPS100", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012007", "id": "NP_012007" } ], "protein_names": [ { "name": "Sporulation-specific wall maturation protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13130" }, { "name": "Sps100p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012007", "id": "NP_012007" } ], "function": [ { "annotation": "Serves a protective function during the early stages of spore wall formation, and contributes to spore wall maturation.", "evidence": [ { "database": "UniProtKB", "id": "P13130", "url": "https://www.uniprot.org/uniprot/P13130#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P13130", "url": "https://www.uniprot.org/uniprot/P13130" } ], "common_name": "Yeast" } ], "gene": [ { "name": "SPS100", "url": "https://www.uniprot.org/uniprot/P13130", "locus": {} } ], "crossref": [ { "id": "856541", "url": "https://www.ncbi.nlm.nih.gov/gene/856541", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036152", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036152", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YHR139C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR139C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FESMAFF", "url": "https://omabrowser.org/oma/group/FESMAFF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2039657at2759", "url": "http://www.orthodb.org/?query=2039657at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_P13130", "url": "http://purl.obolibrary.org/obo/PR_P13130", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012007", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012007", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001181", "url": "https://www.yeastgenome.org/locus/S000001181", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P13130", "url": "https://www.uniprot.org/uniprot/P13130", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13130-1", "url": "https://www.uniprot.org/uniprot/P13130-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKFTSVLAFFLATLTASATPLYKRQNVTSGGGTVPVIITGGPAVSGSQSNVTTTTLFNSTSTLNITQLYQIATQVNQTLQSESSSGIIIVTNWRSIETLSFFCSIVFNTSKTIVITENFLWGVPILSSSDAEGRGTLVAGRDKVVYSGVFPPYTVPVGVLSGQKNVQWFFDACEPTLIASNSTIRTQYSNFTSAQISSNASSGTNTSSSSSSPLVPIIYEEGYSQSLIQSLSSSIQGLVVVSSGTSHNSTVASWTSVDFPVVYASDGSSGHDGSGIGFISNTSIPQGAISAGYLSPIQAQTLLSIAIHNQVTSSSELQQIFPVSQQ", "length": 326, "header": "sp|P13130-1|SS100_YEAST Isoform 1 of Sporulation-specific wall maturation protein OS=Saccharomyces cerevisiae S288C OX=559292 GN=SPS100 PE=2 SV=1 CANONICAL=P13130-1" }, "isoforms": [ { "isoform_ac": "P13130-1", "url": "", "sequence": { "sequence": "MKFTSVLAFFLATLTASATPLYKRQNVTSGGGTVPVIITGGPAVSGSQSNVTTTTLFNSTSTLNITQLYQIATQVNQTLQSESSSGIIIVTNWRSIETLSFFCSIVFNTSKTIVITENFLWGVPILSSSDAEGRGTLVAGRDKVVYSGVFPPYTVPVGVLSGQKNVQWFFDACEPTLIASNSTIRTQYSNFTSAQISSNASSGTNTSSSSSSPLVPIIYEEGYSQSLIQSLSSSIQGLVVVSSGTSHNSTVASWTSVDFPVVYASDGSSGHDGSGIGFISNTSIPQGAISAGYLSPIQAQTLLSIAIHNQVTSSSELQQIFPVSQQ", "length": 326, "header": "sp|P13130-1|SS100_YEAST Isoform 1 of Sporulation-specific wall maturation protein OS=Saccharomyces cerevisiae S288C OX=559292 GN=SPS100 PE=2 SV=1 CANONICAL=P13130-1" }, "locus": { "chromosome": "VIII", "start_pos": 379199, "end_pos": 378222, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YHR139C_mRNA", "url": "https://www.ensembl.org/id/YHR139C_mRNA" }, { "database": "Ensembl Peptide", "id": "YHR139C", "url": "https://www.ensembl.org/id/YHR139C" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 108, "start_aa": "Asn", "end_pos": 108, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn108", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 181, "start_aa": "Asn", "end_pos": 181, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn181", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 190, "start_aa": "Asn", "end_pos": 190, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn190", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 199, "start_aa": "Asn", "end_pos": 199, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn199", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 26, "start_aa": "Asn", "end_pos": 26, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn26", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 281, "start_aa": "Asn", "end_pos": 281, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn281", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P13130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13130#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P13130", "url": "https://www.uniprot.org/uniprot/P13130" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The SPS100 gene of Saccharomyces cerevisiae is activated late in the sporulation process and contributes to spore wall maturation.", "journal": "Mol. Cell. Biol.", "date": "1988", "authors": "Segall J., Law D.T.S.", "evidence": [ { "database": "UniProtKB", "id": "P13130", "url": "https://www.uniprot.org/uniprot/P13130" } ], "reference": [ { "type": "PubMed", "id": "3280971", "url": "https://glygen.org/publication/PubMed/3280971" } ] }, { "title": "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII.", "journal": "Science", "date": "1994", "authors": "Andrews S., Du Z., Fulton L., Hillier L.W., Latreille P., Mardis E., Vaudin M., Waterston R., Wilson R., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Ding H., Cooper J., Vaughan K., Macri C., Louis E.J., Johnston L., Nhan M., Menezes S., Johnston M., Dover J., Wilcox L., Brinkman R., Gattung S., Geisel C., Jier M., Kirsten J., Langston Y., Mouser L., Riles L., St Peter H., Vignati D.", "evidence": [ { "database": "UniProtKB", "id": "P13130", "url": "https://www.uniprot.org/uniprot/P13130" } ], "reference": [ { "type": "PubMed", "id": "8091229", "url": "https://glygen.org/publication/PubMed/8091229" } ] }, { "title": "Characterisation of Saccharomyces cerevisiae ARO8 and ARO9 genes encoding aromatic aminotransferases I and II reveals a new aminotransferase subfamily.", "journal": "Mol. Gen. Genet.", "date": "1998", "authors": "Cartiaux M., Iraqui I., Urrestarazu A., Vissers S.", "evidence": [ { "database": "UniProtKB", "id": "P13130", "url": "https://www.uniprot.org/uniprot/P13130" } ], "reference": [ { "type": "PubMed", "id": "9491083", "url": "https://glygen.org/publication/PubMed/9491083" } ] } ], "pathway": [ { "id": "sce:YHR139C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR139C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "sporulation resulting in formation of a cellular spore", "id": "GO:0030435", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030435", "evidence": [ { "database": "UniProtKB", "id": "P13130", "url": "https://www.uniprot.org/uniprot/P13130" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 108, "end_pos": 110, "annotation": "n_glycosylation_sequon" }, { "start_pos": 181, "end_pos": 183, "annotation": "n_glycosylation_sequon" }, { "start_pos": 190, "end_pos": 192, "annotation": "n_glycosylation_sequon" }, { "start_pos": 199, "end_pos": 201, "annotation": "n_glycosylation_sequon" }, { "start_pos": 205, "end_pos": 207, "annotation": "n_glycosylation_sequon" }, { "start_pos": 248, "end_pos": 250, "annotation": "n_glycosylation_sequon" }, { "start_pos": 26, "end_pos": 28, "annotation": "n_glycosylation_sequon" }, { "start_pos": 281, "end_pos": 283, "annotation": "n_glycosylation_sequon" }, { "start_pos": 50, "end_pos": 52, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 12 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 12 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 12 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 12 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }