{ "uniprot_canonical_ac": "P13098-1", "uniprot_ac": "P13098", "uniprot_id": "ESM8_DROME", "mass": { "chemical_mass": 20303.0, "monoisotopic_mass": 20303.0 }, "refseq": { "ac": "NP_524513", "name": "enhancer of split m8, helix-loop-helix", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524513" }, "gene_names": [ { "name": "E(spl)m8-HLH", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13098", "id": "P13098" }, { "name": "CG8365", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13098", "id": "P13098" }, { "name": "E(spl)m8-HLH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524513", "id": "NP_524513" }, { "name": "E(spl)", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13098", "id": "P13098" }, { "name": "anon-EST:Liang-1.71; bHLHb36; CG8365; clone 1.71; Dmel\\CG8365; e(spl); E(spl); E(Spl); E(spl) m8; E(spl)-C; E(spl)-m8; E(spl)-M8; E(spl)bHLH; E(spl)m8; E(spl)M8; En(spl); En(spl)-C; Enhancer of split m8; Espl; Hes; HES; HLHm8; l(3)96Fd; m8; M8; Su(H)[[m8]]", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524513", "id": "NP_524513" }, { "name": "m8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13098", "id": "P13098" } ], "protein_names": [ { "name": "Enhancer of split m8 protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13098" }, { "name": "CG8365-PA; E(spl)m8-HLH-PA; E(spl)-m8; enhancer of split; enhancer of split m8; enhancer-of-split-m8; Enhancer-of-split", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524513", "id": "NP_524513" }, { "name": "E(spl)m8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13098" }, { "name": "enhancer of split m8, helix-loop-helix", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524513", "id": "NP_524513" } ], "function": [ { "annotation": "Participates in the control of cell fate choice by uncommitted neuroectodermal cells in the embryo (PubMed:2540957). Transcriptional repressor (PubMed:8001118). Binds DNA on N-box motifs: 5'-CACNAG-3' (PubMed:8001118). Part of the Notch signaling pathway (PubMed:22357926).", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098#function" }, { "database": "PubMed", "id": "2540957", "url": "https://glygen.org/publication/PubMed/2540957" }, { "database": "PubMed", "id": "8001118", "url": "https://glygen.org/publication/PubMed/8001118" }, { "database": "PubMed", "id": "22357926", "url": "https://glygen.org/publication/PubMed/22357926" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "E(spl)m8-HLH", "url": "https://www.uniprot.org/uniprot/P13098", "locus": { "chromosome": "3R", "start_pos": 26041008, "end_pos": 26040240, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0000591", "url": "https://www.ensembl.org/id/FBgn0000591" } ] } } ], "crossref": [ { "id": "FBgn0000591", "url": "https://bgee.org/?page=gene&gene_id=FBgn0000591", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd18916", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18916", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0000591", "url": "https://flybase.org/reports/FBgn0000591", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "43161", "url": "https://www.ncbi.nlm.nih.gov/gene/43161", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P13098", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13098*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003650", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003650", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG8365", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG8365", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QKVKKPM", "url": "https://omabrowser.org/oma/group/QKVKKPM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2907677at2759", "url": "http://www.orthodb.org/?query=2907677at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10985", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10985", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10985:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10985:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00010", "url": "http://pfam.xfam.org/family/PF00010", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07527", "url": "http://pfam.xfam.org/family/PF07527", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P13098", "url": "http://purl.obolibrary.org/obo/PR_P13098", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_524513", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524513", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13098-1", "url": "https://www.uniprot.org/uniprot/P13098-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW", "length": 179, "header": "sp|P13098-1|ESM8_DROME Isoform 1 of Enhancer of split m8 protein OS=Drosophila melanogaster OX=7227 GN=E(spl)m8-HLH PE=1 SV=2 CANONICAL=P13098-1" }, "isoforms": [ { "isoform_ac": "P13098-1", "url": "", "sequence": { "sequence": "MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW", "length": 179, "header": "sp|P13098-1|ESM8_DROME Isoform 1 of Enhancer of split m8 protein OS=Drosophila melanogaster OX=7227 GN=E(spl)m8-HLH PE=1 SV=2 CANONICAL=P13098-1" }, "locus": { "chromosome": "3R", "start_pos": 26040860, "end_pos": 26040324, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0084961", "url": "https://www.ensembl.org/id/FBtr0084961" }, { "database": "Ensembl Peptide", "id": "FBpp0084335", "url": "https://www.ensembl.org/id/FBpp0084335" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 159, "end_pos": 159, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P13098", "url": "http://phospho.elm.eu.org/byAccession/P13098.html" }, { "database": "iPTMnet", "id": "P13098", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13098" }, { "database": "PubMed", "id": "15003630", "url": "https://glygen.org/publication/PubMed/15003630" } ], "site_lbl": "Ser159" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Drosophila CK2 regulates eye morphogenesis via phosphorylation of E(spl)M8.", "journal": "Mechanisms of development", "date": "2004", "authors": "Karandikar UC, Trott RL, Yin J, Bishop CP, Bidwai AP", "evidence": [ { "database": "iPTMnet", "id": "P13098", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13098" } ], "reference": [ { "type": "PubMed", "id": "15003630", "url": "https://glygen.org/publication/PubMed/15003630" } ] }, { "title": "Identifying signatures of selection at the enhancer of split neurogenic gene complex in Drosophila.", "journal": "Mol. Biol. Evol.", "date": "2005", "authors": "Macdonald SJ, Long AD", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "reference": [ { "type": "PubMed", "id": "15537803", "url": "https://glygen.org/publication/PubMed/15537803" } ] }, { "title": "Intragenic Hill-Robertson interference influences selection intensity on synonymous mutations in Drosophila.", "journal": "Mol. Biol. Evol.", "date": "2005", "authors": "Comeron J.M., Guthrie T.B.", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "reference": [ { "type": "PubMed", "id": "16120803", "url": "https://glygen.org/publication/PubMed/16120803" } ] }, { "title": "bHLH-O proteins are crucial for Drosophila neuroblast self-renewal and mediate Notch-induced overproliferation.", "journal": "Development", "date": "2012", "authors": "Magadi S.S., Delidakis C., Zacharioudaki E.", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "reference": [ { "type": "PubMed", "id": "22357926", "url": "https://glygen.org/publication/PubMed/22357926" } ] }, { "title": "Closely related transcripts encoded by the neurogenic gene complex enhancer of split of Drosophila melanogaster.", "journal": "EMBO J.", "date": "1989", "authors": "Knust E., Klaembt C., Campos-Ortega J.A., Tietze K.", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "reference": [ { "type": "PubMed", "id": "2540957", "url": "https://glygen.org/publication/PubMed/2540957" } ] }, { "title": "Groucho is required for Drosophila neurogenesis, segmentation, and sex determination and interacts directly with hairy-related bHLH proteins.", "journal": "Cell", "date": "1994", "authors": "Paroush Z, Finley RL Jr, Kidd T, Wainwright SM, Ingham PW, Brent R, Ish-Horowicz D", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "reference": [ { "type": "PubMed", "id": "8001118", "url": "https://glygen.org/publication/PubMed/8001118" } ] } ], "pathway": [ { "id": "dme:Dmel_CG8365", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG8365", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "compound eye development", "id": "GO:0048749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048749", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "anterior/posterior pattern specification", "id": "GO:0009952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009952", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "dendrite morphogenesis", "id": "GO:0048813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048813", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "regulation of neurogenesis", "id": "GO:0050767", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050767", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "mesoderm development", "id": "GO:0007498", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007498", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "sensory organ precursor cell fate determination", "id": "GO:0016360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016360", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "DNA-binding transcription repressor activity, RNA polymerase II-specific", "id": "GO:0001227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001227", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "P13098", "url": "https://www.uniprot.org/uniprot/P13098" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }