{ "uniprot_canonical_ac": "P12841-1", "uniprot_ac": "P12841", "uniprot_id": "FOS_RAT", "mass": { "chemical_mass": 40927.0, "monoisotopic_mass": 40927.0 }, "refseq": { "ac": "NP_071533", "name": "protein c-Fos", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" }, "gene_names": [ { "name": "Fos", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P12841", "id": "P12841" }, { "name": "Fos", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533", "id": "NP_071533" }, { "name": "c-fos", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533", "id": "NP_071533" } ], "protein_names": [ { "name": "Protein c-Fos", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P12841" }, { "name": "Cellular oncogene fos", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12841" }, { "name": "Proto-oncogene c-Fos", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12841" }, { "name": "c-fos oncogene; v-fos FBJ murine osteosarcoma viral oncogene homolog; proto-oncogene c-FOS; proto-oncogene cFOS; FBJ osteosarcoma oncogene", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533", "id": "NP_071533" }, { "name": "protein c-Fos", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533", "id": "NP_071533" } ], "function": [ { "annotation": "C-Fos expression after neonatal handling in social brain regions: Distinctive profile of RHA-rat schizophrenia model on a social preference test.", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" }, { "database": "PubMed", "id": "37567256", "url": "https://glygen.org/publication/PubMed/37567256" } ] }, { "annotation": "Chronic mild stress induces differential depression-like symptoms and c-Fos and 5HT1A protein levels in high-anxiety female Long Evans rats.", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" }, { "database": "PubMed", "id": "36343695", "url": "https://glygen.org/publication/PubMed/36343695" } ] }, { "annotation": "Fluoride impairs mitochondrial translation by targeting miR-221-3p/c-Fos/RMND1 axis contributing to neurodevelopment defects.", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" }, { "database": "PubMed", "id": "36690096", "url": "https://glygen.org/publication/PubMed/36690096" } ] }, { "annotation": "Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex, at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling (By similarity). Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841#function" }, { "database": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] }, { "annotation": "Orthodontic pain: c-Fos expression in rat brain nuclei after rapid maxillary expansion.", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" }, { "database": "PubMed", "id": "36344400", "url": "https://glygen.org/publication/PubMed/36344400" } ] }, { "annotation": "The increase in c-fos expression in epileptic seizures is inhibited by magnetic field application, but not KCa1.1 channel expression.", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" }, { "database": "PubMed", "id": "37598353", "url": "https://glygen.org/publication/PubMed/37598353" } ] } ], "disease": [ { "disease_id": "DOID:0050860", "recommended_name": { "id": "DOID:0050860", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050860", "name": "colorectal adenoma", "description": "An intestinal benign neoplasm that has_material_basis_in epithelial tissue of glandular origin and is located_in colon and located_in rectum." }, "synonyms": [], "evidence": [ { "id": "0050860", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050860" } ] }, { "disease_id": "DOID:0050861", "recommended_name": { "id": "DOID:0050861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050861", "name": "colorectal adenocarcinoma", "description": "A colorectal carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [], "evidence": [ { "id": "0050861", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050861" } ] }, { "disease_id": "DOID:0050865", "recommended_name": { "id": "DOID:0050865", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050865", "name": "tongue squamous cell carcinoma", "description": "A head and neck squamous cell carcinoma that is located_in the tongue." }, "synonyms": [], "evidence": [ { "id": "0050865", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050865" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:11870", "recommended_name": { "id": "DOID:11870", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11870", "name": "Pick's disease", "description": "" }, "synonyms": [ { "id": "DOID:11870", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11870", "name": "Dementia in Pick's disease", "description": "" }, { "id": "DOID:11870", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11870", "name": "LOBAR ATROPHY OF BRAIN", "description": "" }, { "id": "DOID:11870", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11870", "name": "PICK DISEASE OF BRAIN", "description": "" }, { "id": "DOID:11870", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11870", "name": "Pick disease", "description": "" }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "Pick disease", "description": "A rare neurodegenerative disorder leading to dementia. It is characterized by frontotemporal lobar degeneration with accumulation of tau proteins which form Pick bodies." }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "PICK disease of brain", "description": "" }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "Pick disease", "description": "" }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "dementia in Pick's disease", "description": "" }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "lobar atrophy of brain", "description": "" }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "Pick disease of the brain", "description": "" }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "Pick's disease", "description": "" }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "dementia with lobar atrophy and neuronal cytoplasmic inclusions", "description": "" }, { "id": "MONDO:0008243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008243", "name": "lobar atrophy of the brain", "description": "" }, { "id": "MIM:172700", "resource": "MIM", "url": "https://www.omim.org/entry/172700", "name": "Pick disease of the brain", "description": "Pick disease of the brain" } ], "evidence": [ { "id": "11870", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11870" } ] }, { "disease_id": "DOID:1984", "recommended_name": { "id": "DOID:1984", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1984", "name": "rectal benign neoplasm", "description": "An intestinal benign neoplasm located_in the rectum." }, "synonyms": [ { "id": "DOID:1984", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1984", "name": "Rectal tumor", "description": "" }, { "id": "DOID:1984", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1984", "name": "neoplasm of rectum", "description": "" }, { "id": "DOID:1984", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1984", "name": "rectum neoplasm", "description": "" } ], "evidence": [ { "id": "1984", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1984" } ] }, { "disease_id": "DOID:2921", "recommended_name": { "id": "DOID:2921", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2921", "name": "glomerulonephritis", "description": "A nephritis that causes inflammation of the glomeruli located_in kidney." }, "synonyms": [], "evidence": [ { "id": "2921", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2921" } ] }, { "disease_id": "DOID:3744", "recommended_name": { "id": "DOID:3744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3744", "name": "cervical squamous cell carcinoma", "description": "A cervix carcinoma that has_material_basis_in squamous cells of the cervix." }, "synonyms": [ { "id": "DOID:3744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3744", "name": "squamous cell carcinoma of cervix", "description": "" }, { "id": "DOID:3744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3744", "name": "squamous cell carcinoma of the Cervix Uteri", "description": "" } ], "evidence": [ { "id": "3744", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3744" } ] }, { "disease_id": "DOID:6000", "recommended_name": { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "congestive heart failure", "description": "A heart disease that is characterized by any structural or functional cardiac disorder that impairs the ability of the heart to fill with or pump a sufficient amount of blood throughout the body." }, "synonyms": [ { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "CHF", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Cardiac Failure Congestive", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Congestive heart disease", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Weak heart", "description": "" } ], "evidence": [ { "id": "6000", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:6000" } ] }, { "disease_id": "DOID:898", "recommended_name": { "id": "DOID:898", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:898", "name": "autosomal dominant polycystic kidney disease", "description": "A polycystic kidney disease characterized by the presence of multiple cysts located_in the kidney resulting from ciliopathy that disrupts the function of primary cilium, inherited in an autosomal dominant fashion." }, "synonyms": [ { "id": "DOID:898", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:898", "name": "Congenital biliary ectasias", "description": "" }, { "id": "DOID:898", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:898", "name": "POLYCYSTIC KIDNEY AND HEPATIC DISEASE 1", "description": "" } ], "evidence": [ { "id": "898", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:898" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 232, "end_pos": 232, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes HA-RAS-mediated activation. Loss of in vitro ERK2-mediated phosphorylation. No change in sumoylation levels.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" } ] }, { "start_pos": 325, "end_pos": 325, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of NGF-mediated phosphorylation; when associated with A-331.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] }, { "start_pos": 331, "end_pos": 331, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of NGF-mediated phosphorylation; when associated with A-325.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] }, { "start_pos": 343, "end_pos": 345, "sequence_org": "FTY", "sequence_mut": "ATA", "comment": "Decreased phosphorylation levels. Reduced NGF-mediated enhanced transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] }, { "start_pos": 362, "end_pos": 362, "sequence_org": "S", "sequence_mut": "A", "comment": "Some loss of protein stabilization on NGF-treatment; when associated with D-374.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] }, { "start_pos": 362, "end_pos": 362, "sequence_org": "S", "sequence_mut": "D", "comment": "Increased protein stabilization on NGF-treatment, but no increase when treated with MAPK-inhibitor; when associated with D-374.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] }, { "start_pos": 374, "end_pos": 374, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduced protein stabilization on NGF stimulation.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] }, { "start_pos": 374, "end_pos": 374, "sequence_org": "S", "sequence_mut": "D", "comment": "Increased protein stabilization on NGF-treatment, but no increase when treated with MAPK-inhibitor; when associated with D-362. Some loss of protein stablization on NGF-treatment; wnen associated with A-362.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "common_name": "Rat" } ], "gene": [ { "name": "Fos", "url": "https://www.uniprot.org/uniprot/P12841", "locus": { "chromosome": "6", "start_pos": 105124036, "end_pos": 105121170, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000008015", "url": "https://www.ensembl.org/id/ENSRNOG00000008015" } ] } } ], "crossref": [ { "id": "ENSRNOG00000008015", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000008015", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14721", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14721", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "314322", "url": "https://www.ncbi.nlm.nih.gov/gene/314322", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P12841", "url": "https://www.ebi.ac.uk/intact/interactors/id:P12841*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000837", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000837", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:314322", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:314322", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FTYPEAE", "url": "https://omabrowser.org/oma/group/FTYPEAE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4614365at2759", "url": "http://www.orthodb.org/?query=4614365at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23351", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23351", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23351:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23351:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00170", "url": "http://pfam.xfam.org/family/PF00170", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P12841", "url": "http://purl.obolibrary.org/obo/PR_P12841", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559580", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2871796", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-450341", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-450341", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2626", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2626", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12841-1", "url": "https://www.uniprot.org/uniprot/P12841-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFTLPLLNDPEPKPSLEPVKNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYAADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 380, "header": "sp|P12841-1|FOS_RAT Isoform 1 of Protein c-Fos OS=Rattus norvegicus OX=10116 GN=Fos PE=1 SV=1 CANONICAL=P12841-1" }, "isoforms": [ { "isoform_ac": "P12841-1", "url": "", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFTLPLLNDPEPKPSLEPVKNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYAADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 380, "header": "sp|P12841-1|FOS_RAT Isoform 1 of Protein c-Fos OS=Rattus norvegicus OX=10116 GN=Fos PE=1 SV=1 CANONICAL=P12841-1" }, "locus": { "chromosome": "6", "start_pos": 105123739, "end_pos": 105121322, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000010712", "url": "https://www.ensembl.org/id/ENSRNOT00000010712" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000010712", "url": "https://www.ensembl.org/id/ENSRNOP00000010712" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "site_lbl": "Tyr10" }, { "start_pos": 232, "end_pos": 232, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" }, { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" } ], "site_lbl": "Thr232" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "site_lbl": "Tyr30" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ], "site_lbl": "Thr325" }, { "start_pos": 331, "end_pos": 331, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ], "site_lbl": "Thr331" }, { "start_pos": 362, "end_pos": 362, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1, MAPK3 and RPS6KA3", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" }, { "database": "PubMed", "id": "8421668", "url": "https://glygen.org/publication/PubMed/8421668" }, { "database": "PubMed", "id": "8622865", "url": "https://glygen.org/publication/PubMed/8622865" } ], "site_lbl": "Ser362" }, { "start_pos": 374, "end_pos": 374, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" }, { "database": "PubMed", "id": "8622865", "url": "https://glygen.org/publication/PubMed/8622865" } ], "site_lbl": "Ser374" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Sustained activation of extracellular signal-regulated kinase by nerve growth factor regulates c-fos protein stabilization and transactivation in PC12 cells.", "journal": "J. Neurochem.", "date": "2006", "authors": "Pellegrino MJ, Stork PJ", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" } ], "reference": [ { "type": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] }, { "title": "Expression and purification of the leucine zipper and DNA-binding domains of Fos and Jun: both Fos and Jun contact DNA directly.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1990", "authors": "Abate C, Luk D, Gentz R, Rauscher FJ 3rd, Curran T", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "reference": [ { "type": "PubMed", "id": "2105492", "url": "https://glygen.org/publication/PubMed/2105492" } ] }, { "title": "Isolation and characterization of the c-fos(rat) cDNA and analysis of post-translational modification in vitro.", "journal": "Oncogene", "date": "1987", "authors": "Curran T, Gordon MB, Rubino KL, Sambucetti LC", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "reference": [ { "type": "PubMed", "id": "3325886", "url": "https://glygen.org/publication/PubMed/3325886" } ] }, { "title": "Chronic mild stress induces differential depression-like symptoms and c-Fos and 5HT1A protein levels in high-anxiety female Long Evans rats.", "journal": "Behavioural brain research", "date": "2023-02-13", "authors": "Calhoun Corey A, Lattouf Christine, Lewis Victoria, Barrientos Heidi, Donaldson S Tiffany", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" } ], "reference": [ { "type": "PubMed", "id": "36343695", "url": "https://glygen.org/publication/PubMed/36343695" } ] }, { "title": "Orthodontic pain: c-Fos expression in rat brain nuclei after rapid maxillary expansion.", "journal": "Journal of the World federation of orthodontists", "date": "2022-11-04", "authors": "Reis Caio Luiz Bitencourt, Pingueiro-Okada Elaine Machado, Luiz Kelly Galisteu, Pedroso Gabriela Leite, Matsumoto Mirian Aiko Nakame, de Menezes Luciane Macedo, K\u00fcchler Erika Calvano, Nascimento Glauce Crivelaro, Stuani Maria Bernadete Sasso", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" } ], "reference": [ { "type": "PubMed", "id": "36344400", "url": "https://glygen.org/publication/PubMed/36344400" } ] }, { "title": "Fluoride impairs mitochondrial translation by targeting miR-221-3p/c-Fos/RMND1 axis contributing to neurodevelopment defects.", "journal": "The Science of the total environment", "date": "2023-04-15", "authors": "Li Dongjie, Zhao Qian, Xie Li, Wang Chenxi, Tian Zhiyuan, Tang Huayang, Xia Tao, Wang Aiguo", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" } ], "reference": [ { "type": "PubMed", "id": "36690096", "url": "https://glygen.org/publication/PubMed/36690096" } ] }, { "title": "c-Fos expression after neonatal handling in social brain regions: Distinctive profile of RHA-rat schizophrenia model on a social preference test.", "journal": "Behavioural brain research", "date": "2023-09-13", "authors": "Sampedro-Viana D, Ca\u00f1ete T, Sanna F, Oliveras I, Castillo-Ruiz Mdm, Corda M G, Giorgi O, Tobe\u00f1a A, Fern\u00e1ndez-Teruel A", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" } ], "reference": [ { "type": "PubMed", "id": "37567256", "url": "https://glygen.org/publication/PubMed/37567256" } ] }, { "title": "The increase in c-fos expression in epileptic seizures is inhibited by magnetic field application, but not KCa1.1 channel expression.", "journal": "Electromagnetic biology and medicine", "date": "2023-04-03", "authors": "Akda\u011f Mehmet Z\u00fclkif, O\u011fra\u015f Emrah, Do\u011fanyi\u011fit Z\u00fcleyha, Aky\u00fcz Enes, Akdag Mahmut Berat, Okan Asl\u0131, Akpolat Veysi, K\u00fcll\u00fc I Rem", "evidence": [ { "database": "RefSeq", "id": "NP_071533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071533" } ], "reference": [ { "type": "PubMed", "id": "37598353", "url": "https://glygen.org/publication/PubMed/37598353" } ] }, { "title": "Phosphorylation of the c-Fos and c-Jun HOB1 motif stimulates its activation capacity.", "journal": "Nucleic acids research", "date": "1994", "authors": "Bannister AJ, Brown HJ, Sutherland JA, Kouzarides T", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" } ], "reference": [ { "type": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" } ] }, { "title": "Identification of a nerve growth factor- and epidermal growth factor-regulated protein kinase that phosphorylates the protooncogene product c-Fos.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Taylor LK, Marshak DR, Landreth GE", "evidence": [ { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" } ], "reference": [ { "type": "PubMed", "id": "8421668", "url": "https://glygen.org/publication/PubMed/8421668" } ] }, { "title": "Phosphorylation of c-Fos at the C-terminus enhances its transforming activity.", "journal": "Oncogene", "date": "1996", "authors": "Chen RH, Juo PC, Curran T, Blenis J", "evidence": [ { "database": "iPTMnet", "id": "P12841", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12841" } ], "reference": [ { "type": "PubMed", "id": "8622865", "url": "https://glygen.org/publication/PubMed/8622865" } ] }, { "title": "Rat maf-related factors: the specificities of DNA binding and heterodimer formation.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Sakai M., Nishi S., Matsushima-Hibiya Y.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "reference": [ { "type": "PubMed", "id": "9571165", "url": "https://glygen.org/publication/PubMed/9571165" } ] } ], "pathway": [ { "id": "rno:314322", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:314322", "resource": "KEGG Pathway" }, { "id": "R-RNO-2559580", "name": "Oxidative Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559580", "resource": "Reactome", "description": "Oxidative Stress Induced Senescence" }, { "id": "R-RNO-2871796", "name": "FCERI mediated MAPK activation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2871796", "resource": "Reactome", "description": "FCERI mediated MAPK activation" }, { "id": "R-RNO-450341", "name": "Activation of the AP-1 family of transcription factors", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-450341", "resource": "Reactome", "description": "Activation of the AP-1 family of transcription factors" } ], "orthologs": [ { "uniprot_canonical_ac": "P01100-1", "protein_name": "Protein c-Fos", "gene_name": "FOS", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 380 }, "evidence": [ { "id": "45227897", "url": "http://www.informatics.jax.org/homology/45227897", "database": "MGI" }, { "id": "P12841", "url": "https://omabrowser.org/oma/group/P12841/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01101-1", "protein_name": "Protein c-Fos", "gene_name": "Fos", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFTLPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYAADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL", "length": 380 }, "evidence": [ { "id": "45227897", "url": "http://www.informatics.jax.org/homology/45227897", "database": "MGI" }, { "id": "P12841", "url": "https://omabrowser.org/oma/group/P12841/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 49, "go_terms": [ { "name": "osteoclast differentiation", "id": "GO:0030316", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030316", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to organic cyclic compound", "id": "GO:0014070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014070", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to extracellular stimulus", "id": "GO:0031668", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031668", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "transforming growth factor beta receptor signaling pathway", "id": "GO:0007179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007179", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to calcium ion", "id": "GO:0071277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071277", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to hypoxia", "id": "GO:0071456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "female pregnancy", "id": "GO:0007565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007565", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to mechanical stimulus", "id": "GO:0009612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009612", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to progesterone", "id": "GO:0032570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032570", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to hormone stimulus", "id": "GO:0032870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032870", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to steroid hormone", "id": "GO:0048545", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048545", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to toxic substance", "id": "GO:0009636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009636", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to insulin", "id": "GO:0032868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032868", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to cytokine", "id": "GO:0034097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034097", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "SMAD protein signal transduction", "id": "GO:0060395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060395", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to activity", "id": "GO:0014823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014823", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "conditioned taste aversion", "id": "GO:0001661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001661", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to transforming growth factor beta stimulus", "id": "GO:0071560", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071560", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to muscle stretch", "id": "GO:0035994", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035994", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to corticosterone", "id": "GO:0051412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051412", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to cAMP", "id": "GO:0051591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051591", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "skeletal muscle cell differentiation", "id": "GO:0035914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035914", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to reactive oxygen species", "id": "GO:0034614", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034614", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to cadmium ion", "id": "GO:0071276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071276", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to epidermal growth factor stimulus", "id": "GO:0071364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071364", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to light stimulus", "id": "GO:0009416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009416", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to immobilization stress", "id": "GO:0035902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035902", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to parathyroid hormone stimulus", "id": "GO:0071374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071374", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to zinc ion starvation", "id": "GO:0034224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034224", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "myoblast proliferation", "id": "GO:0051450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051450", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to phorbol 13-acetate 12-myristate", "id": "GO:1904628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904628", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "positive regulation of osteoclast differentiation", "id": "GO:0045672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045672", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "positive regulation of miRNA transcription", "id": "GO:1902895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902895", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cellular response to prolactin", "id": "GO:1990646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990646", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "response to gravity", "id": "GO:0009629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009629", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "skeletal muscle cell proliferation", "id": "GO:0014856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014856", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "mononuclear cell differentiation", "id": "GO:1903131", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903131", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 16, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "RNA polymerase II core promoter sequence-specific DNA binding", "id": "GO:0000979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000979", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "R-SMAD binding", "id": "GO:0070412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070412", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "transcription coregulator binding", "id": "GO:0001221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001221", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "protein-DNA complex", "id": "GO:0032993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032993", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulator complex", "id": "GO:0090575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" }, { "name": "transcription factor AP-1 complex", "id": "GO:0035976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035976", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 258, "end_pos": 260, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated in the C-terminal upon stimulation by nerve growth factor (NGF) and epidermal growth factor (EGF) (By similarity). Phosphorylated, in vitro, by MAPK and RSK1. Phosphorylation on both Ser-362 and Ser-374 by MAPK1/2 and RSK1/2 leads to protein stabilization with phosphorylation on Ser-374 being the major site for protein stabilization on NGF stimulation. Phosphorylation on Ser-362 and Ser-374 primes further phosphorylations on Thr-325 and Thr-331 through promoting docking of MAPK to the DEF domain. Phosphorylation on Thr-232, induced by HA-RAS, activates the transcriptional activity and antagonizes sumoylation. Phosphorylation on Ser-362 by RSK2 in osteoblasts contributes to osteoblast transformation.", "evidence": [ { "database": "UniProtKB", "id": "P12841", "url": "https://www.uniprot.org/uniprot/P12841" }, { "database": "PubMed", "id": "7816602", "url": "https://glygen.org/publication/PubMed/7816602" }, { "database": "PubMed", "id": "17223854", "url": "https://glygen.org/publication/PubMed/17223854" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }