{ "uniprot_canonical_ac": "P11590-1", "uniprot_ac": "P11590", "uniprot_id": "MUP4_MOUSE", "mass": { "chemical_mass": 20542.0, "monoisotopic_mass": 20542.0 }, "refseq": { "ac": "NP_032674", "name": "major urinary protein 4 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032674" }, "gene_names": [ { "name": "Mup4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P11590", "id": "P11590" }, { "name": "Mup-4; Mup1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032674", "id": "NP_032674" }, { "name": "Mup4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032674", "id": "NP_032674" } ], "protein_names": [ { "name": "Major urinary protein 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P11590" }, { "name": "MUP 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11590" }, { "name": "major urinary protein 1; MUP 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032674", "id": "NP_032674" }, { "name": "major urinary protein 4 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032674", "id": "NP_032674" } ], "function": [ { "annotation": "Binds pheromones, likely to displace pheromones complexed to urinary MUPs and transport them to the vomeronasal organ (VNO) where they associate with their neuronal receptor(s). MUP4 is highly specific for the male mouse pheromone 2-sec-butyl-4,5-dihydrothiazole (SBT).", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590#function" }, { "database": "PubMed", "id": "20509168", "url": "https://glygen.org/publication/PubMed/20509168" }, { "database": "PubMed", "id": "12192080", "url": "https://glygen.org/publication/PubMed/12192080" } ] }, { "annotation": "Data determine the X-ray crystal structure of major urinary protein-IV bound to three mouse pheromones: SBT, 2,5-dimethylpyrazine, and 2-heptanone, and report the structure of MUP-IV with 2-ethylhexanol bound in the cavity.", "evidence": [ { "database": "RefSeq", "id": "NP_032674", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032674" }, { "database": "PubMed", "id": "20509168", "url": "https://glygen.org/publication/PubMed/20509168" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mup4", "url": "https://www.uniprot.org/uniprot/P11590", "locus": { "chromosome": "4", "start_pos": 59956804, "end_pos": 59960710, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000041333", "url": "https://www.ensembl.org/id/ENSMUSG00000041333" } ] } } ], "crossref": [ { "id": "ENSMUSG00000041333", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000041333", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19428", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19428", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "17843", "url": "https://www.ncbi.nlm.nih.gov/gene/17843", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000566", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000566", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002345", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002345", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002971", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002971", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012674", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012674", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022272", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022272", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:17843", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17843", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "97236", "url": "http://www.informatics.jax.org/marker/MGI:97236", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FHTKVNG", "url": "https://omabrowser.org/oma/group/FHTKVNG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4635611at2759", "url": "http://www.orthodb.org/?query=4635611at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11430", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11430", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11430:SF76", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11430:SF76", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3KFF", "url": "https://www.rcsb.org/structure/3KFF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KFG", "url": "https://www.rcsb.org/structure/3KFG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KFH", "url": "https://www.rcsb.org/structure/3KFH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KFI", "url": "https://www.rcsb.org/structure/3KFI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00061", "url": "http://pfam.xfam.org/family/PF00061", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P11590", "url": "http://purl.obolibrary.org/obo/PR_P11590", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_032674", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032674", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11590-1", "url": "https://www.uniprot.org/uniprot/P11590-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLLLCLGLTLVCIHAEEATSKGQNLNVEKINGEWFSILLASDKREKIEEHGSMRVFVEHIHVLENSLAFKFHTVIDGECSEIFLVADKTEKAGEYSVMYDGFNTFTILKTDYDNYIMFHLINEKDGKTFQLMELYGRKADLNSDIKEKFVKLCEEHGIIKENIIDLTKTNRCLKARE", "length": 178, "header": "sp|P11590-1|MUP4_MOUSE Isoform 1 of Major urinary protein 4 OS=Mus musculus OX=10090 GN=Mup4 PE=1 SV=1 CANONICAL=P11590-1" }, "isoforms": [ { "isoform_ac": "P11590-1", "url": "", "sequence": { "sequence": "MKLLLCLGLTLVCIHAEEATSKGQNLNVEKINGEWFSILLASDKREKIEEHGSMRVFVEHIHVLENSLAFKFHTVIDGECSEIFLVADKTEKAGEYSVMYDGFNTFTILKTDYDNYIMFHLINEKDGKTFQLMELYGRKADLNSDIKEKFVKLCEEHGIIKENIIDLTKTNRCLKARE", "length": 178, "header": "sp|P11590-1|MUP4_MOUSE Isoform 1 of Major urinary protein 4 OS=Mus musculus OX=10090 GN=Mup4 PE=1 SV=1 CANONICAL=P11590-1" }, "locus": { "chromosome": "4", "start_pos": 59960599, "end_pos": 59957868, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000075973", "url": "https://www.ensembl.org/id/ENSMUST00000075973" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000075356", "url": "https://www.ensembl.org/id/ENSMUSP00000075356" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Pheromone binding by polymorphic mouse major urinary proteins.", "journal": "Protein Sci.", "date": "2002", "authors": "Sharrow SD, Vaughn JL, Zidek L, Novotny MV, Stone MJ", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "reference": [ { "type": "PubMed", "id": "12192080", "url": "https://glygen.org/publication/PubMed/12192080" } ] }, { "title": "High resolution X-ray structures of mouse major urinary protein nasal isoform in complex with pheromones.", "journal": "Protein Sci.", "date": "2010", "authors": "Perez-Miller S, Zou Q, Novotny MV, Hurley TD", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" }, { "database": "RefSeq", "id": "NP_032674", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032674" } ], "reference": [ { "type": "PubMed", "id": "20509168", "url": "https://glygen.org/publication/PubMed/20509168" } ] }, { "title": "Nucleotide sequences of liver, lachrymal, and submaxillary gland mouse major urinary protein mRNAs: mosaic structure and construction of panels of gene-specific synthetic oligonucleotide probes.", "journal": "Mol. Cell. Biol.", "date": "1987", "authors": "Derman E., Gilmartin M., Shahan K.", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "reference": [ { "type": "PubMed", "id": "3600652", "url": "https://glygen.org/publication/PubMed/3600652" } ] }, { "title": "Expression of six mouse major urinary protein genes in the mammary, parotid, sublingual, submaxillary, and lachrymal glands and in the liver.", "journal": "Mol. Cell. Biol.", "date": "1987", "authors": "Shi Y., Denaro M., Derman E., Gilmartin M., Shahan K.", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "reference": [ { "type": "PubMed", "id": "3600653", "url": "https://glygen.org/publication/PubMed/3600653" } ] } ], "pathway": [ { "id": "mmu:17843", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17843", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5YBU2-1", "protein_name": "Alpha-2u globulin PGCL3", "gene_name": "LOC259244", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLLLLLLCLGLTLVCGHAEEASSTTGNRDVDKLNGDWFSIVVASDKREKIEENGSMRVFVQHIRVLENSLAFKFRIKENGVCTEFSLVAYKTPKDGEYFVEYDGGNTFTILKTDYDRYVMFHLVNFKNGETFQLMELYGRTKDLSSDIKEKFAKLCVAHGITRDNIIDLTKTVDLVPEHVLFLTLQIVVSRPEVEERPEPPVLSGDFSPGLQHHNFLSMEHPEKFCDLISILFHR", "length": 236 }, "evidence": [ { "id": "45245091", "url": "http://www.informatics.jax.org/homology/45245091", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P02761-1", "protein_name": "Major urinary protein", "gene_name": "", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLLLLLLCLGLTLVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHIDVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG", "length": 181 }, "evidence": [ { "id": "45245091", "url": "http://www.informatics.jax.org/homology/45245091", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "positive regulation of lipid metabolic process", "id": "GO:0045834", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045834", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "negative regulation of lipid storage", "id": "GO:0010888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010888", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "positive regulation of protein kinase B signaling", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "glucose homeostasis", "id": "GO:0042593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042593", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "negative regulation of insulin secretion involved in cellular response to glucose stimulus", "id": "GO:0061179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061179", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "energy reserve metabolic process", "id": "GO:0006112", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006112", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "heat generation", "id": "GO:0031649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031649", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "positive regulation of glucose metabolic process", "id": "GO:0010907", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010907", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "negative regulation of gluconeogenesis", "id": "GO:0045721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045721", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "locomotor rhythm", "id": "GO:0045475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045475", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "negative regulation of lipid biosynthetic process", "id": "GO:0051055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051055", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "mitochondrion morphogenesis", "id": "GO:0070584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070584", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "cellular response to lipid", "id": "GO:0071396", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071396", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "aerobic respiration", "id": "GO:0009060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009060", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "insulin receptor activity", "id": "GO:0005009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005009", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "small molecule binding", "id": "GO:0036094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036094", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "pheromone binding", "id": "GO:0005550", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005550", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P11590", "url": "https://www.uniprot.org/uniprot/P11590" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }