{ "uniprot_canonical_ac": "P11438-1", "uniprot_ac": "P11438", "uniprot_id": "LAMP1_MOUSE", "mass": { "chemical_mass": 43865.0, "monoisotopic_mass": 43865.0 }, "refseq": { "ac": "NP_001304282", "name": "lysosome-associated membrane glycoprotein 1 isoform 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304282" }, "gene_names": [ { "name": "Lamp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P11438", "id": "P11438" }, { "name": "CD107a; Lamp-1; LGP-120; LGP-A; P2B; Perk", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304282", "id": "NP_001304282" }, { "name": "Lamp-1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11438", "id": "P11438" }, { "name": "Lamp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304282", "id": "NP_001304282" } ], "protein_names": [ { "name": "Lysosome-associated membrane glycoprotein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P11438" }, { "name": "120 kDa lysosomal membrane glycoprotein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11438" }, { "name": "CD107 antigen-like family member A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11438" }, { "name": "LAMP-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11438" }, { "name": "LGP-120", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11438" }, { "name": "LGP-A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11438" }, { "name": "Lysosomal membrane glycoprotein A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11438" }, { "name": "Lysosome-associated membrane protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11438" }, { "name": "P2B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11438" }, { "name": "lysosomal membrane glycoprotein A; CD107 antigen-like family member A; lysosome-associated membrane protein 1; 120 kDa lysosomal membrane glycoprotein; Lamp I; lysosomal membrane glycoprotein 1; LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 1 PRECURSOR (LAMP-1) (LGP-A) (LGP-120) (CD107A) (P2B)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304282", "id": "NP_001304282" }, { "name": "lysosome-associated membrane glycoprotein 1 isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304282", "id": "NP_001304282" } ], "function": [ { "annotation": "Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, autophagy, and cholesterol homeostasis (PubMed:15121881). Also plays an important role in NK-cells cytotoxicity (PubMed:23847195). Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule (By similarity). In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content (By similarity) (PubMed:23847195). Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438#function" }, { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#function" }, { "database": "PubMed", "id": "15121881", "url": "https://glygen.org/publication/PubMed/15121881" }, { "database": "PubMed", "id": "23847195", "url": "https://glygen.org/publication/PubMed/23847195" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs217081787", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs217081787" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 126, "end_pos": 126, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAI->NAT).", "chr_id": "8", "chr_pos": "13217369", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I126", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3388964480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388964480" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 31, "end_pos": 31, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "8", "chr_pos": "13215894", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N31", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3388967256", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388967256" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGI).", "chr_id": "8", "chr_pos": "13215900", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3388948594", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388948594" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 397, "end_pos": 397, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KRS->NRS).", "chr_id": "8", "chr_pos": "13224528", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K397", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Lamp1", "url": "https://www.uniprot.org/uniprot/P11438", "locus": { "chromosome": "8", "start_pos": 13225338, "end_pos": 13209161, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000031447", "url": "https://www.ensembl.org/id/ENSMUSG00000031447" } ] } } ], "crossref": [ { "id": "ENSMUSG00000031447", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000031447", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12087", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12087", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "16783", "url": "https://www.ncbi.nlm.nih.gov/gene/16783", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "GPDB0003349", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0003349", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "P11438", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11438*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002000", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002000", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018134", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018134", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:16783", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:16783", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "96745", "url": "http://www.informatics.jax.org/marker/MGI:96745", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P11438", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11438", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CQMDQNQ", "url": "https://omabrowser.org/oma/group/CQMDQNQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5404772at2759", "url": "http://www.orthodb.org/?query=5404772at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11506", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11506", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11506:SF35", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11506:SF35", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5GV0", "url": "https://www.rcsb.org/structure/5GV0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01299", "url": "http://pfam.xfam.org/family/PF01299", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P11438", "url": "http://purl.obolibrary.org/obo/PR_P11438", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001304282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304282", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P11438", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11438-1", "url": "https://www.uniprot.org/uniprot/P11438-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI", "length": 406, "header": "sp|P11438-1|LAMP1_MOUSE Isoform 1 of Lysosome-associated membrane glycoprotein 1 OS=Mus musculus OX=10090 GN=Lamp1 PE=1 SV=2 CANONICAL=P11438-1" }, "isoforms": [ { "isoform_ac": "P11438-1", "url": "", "sequence": { "sequence": "MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI", "length": 406, "header": "sp|P11438-1|LAMP1_MOUSE Isoform 1 of Lysosome-associated membrane glycoprotein 1 OS=Mus musculus OX=10090 GN=Lamp1 PE=1 SV=2 CANONICAL=P11438-1" }, "locus": { "chromosome": "8", "start_pos": 13224555, "end_pos": 13209389, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000033824", "url": "https://www.ensembl.org/id/ENSMUST00000033824" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000033824", "url": "https://www.ensembl.org/id/ENSMUSP00000033824" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" }, { "id": "19656770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19656770" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 214, "start_aa": "Asn", "end_pos": 214, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn214", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 219, "start_aa": "Asn", "end_pos": 219, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn219", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 240, "start_aa": "Asn", "end_pos": 240, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn240", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 252, "start_aa": "Asn", "end_pos": 252, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn252", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 252, "start_aa": "Asn", "end_pos": 252, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn252", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 252, "start_aa": "Asn", "end_pos": 252, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn252", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 252, "start_aa": "Asn", "end_pos": 252, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn252", "evidence": [ { "id": "P11438", "database": "UniCarbKB", "url": "" }, { "id": "16170054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16170054" }, { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 282, "start_aa": "Asn", "end_pos": 282, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn282", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 282, "start_aa": "Asn", "end_pos": 282, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn282", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 311, "start_aa": "Asn", "end_pos": 311, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn311", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 31, "start_aa": "Asn", "end_pos": 31, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn31", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 52, "start_aa": "Asn", "end_pos": 52, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn52", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G10039CR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G39368QD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G39643OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G65540UB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G76329HL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G76915KR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G79896BV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "2494", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2494" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 97, "start_aa": "Asn", "end_pos": 97, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn97", "evidence": [ { "id": "P11438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" }, { "id": "16944957", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16944957" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P11438", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11438" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Normal lysosomal morphology and function in LAMP-1-deficient mice.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Hartmann D., Saftig P., Tanaka Y., von Figura K., Luellmann-Rauch R., Guhde G., Andrejewski N., Punnonen E.L.", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "10212251", "url": "https://glygen.org/publication/PubMed/10212251" } ] }, { "title": "Disturbed cholesterol traffic but normal proteolytic function in LAMP-1/LAMP-2 double-deficient fibroblasts.", "journal": "Mol. Biol. Cell", "date": "2004", "authors": "Hartmann D., Saftig P., Tanaka Y., von Figura K., Eskelinen E.L., Schmidt C.K., Knecht E., Fuertes G., Heeren J., Luellmann-Rauch R., Salvador N., Neu S., Willenborg M.", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "15121881", "url": "https://glygen.org/publication/PubMed/15121881" } ] }, { "title": "High throughput quantitative glycomics and glycoform-focused proteomics of murine dermis and epidermis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005", "authors": "Uematsu R, Furukawa J, Nakagawa H, Shinohara Y, Deguchi K, Monde K, Nishimura S", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" }, { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" }, { "database": "UniCarbKB", "id": "P11438", "url": "" } ], "reference": [ { "type": "PubMed", "id": "16170054", "url": "https://glygen.org/publication/PubMed/16170054" } ] }, { "title": "Proteome-wide characterization of N-glycosylation events by diagonal chromatography.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ghesquiere B, Van Damme J, Martens L, Vandekerckhove J, Gevaert K", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" }, { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "16944957", "url": "https://glygen.org/publication/PubMed/16944957" } ] }, { "title": "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.", "journal": "Nature biotechnology", "date": "2009", "authors": "Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" }, { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "19349973", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "title": "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Gundry RL, Raginski K, Tarasova Y, Tchernyshyov I, Bausch-Fluck D, Elliott ST, Boheler KR, Van Eyk JE, Wollscheid B", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438#ptm_processing" }, { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "19656770", "url": "https://glygen.org/publication/PubMed/19656770" } ] }, { "title": "Characterization and cloning of lgp110, a lysosomal membrane glycoprotein from mouse and rat cells.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Granger BL, Green SA, Gabel CA, Howe CL, Mellman I, Helenius A", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "2142158", "url": "https://glygen.org/publication/PubMed/2142158" } ] }, { "title": "The lysosomal polypeptide transporter TAPL is stabilized by interaction with LAMP-1 and LAMP-2.", "journal": "J. Cell Sci.", "date": "2012", "authors": "Saftig P., Abele R., Demirel O., Tampe R., Wolters D., Blanz J., Jan I.", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "22641697", "url": "https://glygen.org/publication/PubMed/22641697" } ] }, { "title": "The disulfide structure of mouse lysosome-associated membrane protein 1.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Earles B.J., August J.T., Arterburn L.M.", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "2332434", "url": "https://glygen.org/publication/PubMed/2332434" } ] }, { "title": "Surface CD107a/LAMP-1 protects natural killer cells from degranulation-associated damage.", "journal": "Blood", "date": "2013", "authors": "Saftig P., Schmidt H., Chiang S.C., Watzl C., Janssen O., Bryceson Y.T., Cerwenka A., Stojanovic A., Claus M., Cohnen A.", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "23847195", "url": "https://glygen.org/publication/PubMed/23847195" } ] }, { "title": "Molecular characterization of P2B/LAMP-1, a major protein target of a metastasis-associated oligosaccharide structure.", "journal": "Cancer Res.", "date": "1989", "authors": "Heffernan M, Yousefi S, Dennis JW", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "2676155", "url": "https://glygen.org/publication/PubMed/2676155" } ] }, { "title": "Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis.", "journal": "Nature communications", "date": "2019", "authors": "Riley NM, Hebert AS, Westphall MS, Coon JJ", "evidence": [ { "database": "GlyConnect", "id": "2494", "url": "https://glyconnect.expasy.org/browser/proteins/2494" } ], "reference": [ { "type": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "title": "The NK cell granule protein NKG7 regulates cytotoxic granule exocytosis and inflammation.", "journal": "Nat. Immunol.", "date": "2020", "authors": "Ng SS, De Labastida Rivera F, Yan J, Corvino D, Das I, Zhang P, Kuns R, Chauhan SB, Hou J, Li XY, Frame TCM, McEnroe BA, Moore E, Na J, Engel JA, Soon MSF, Singh B, Kueh AJ, Herold MJ, Montes de Oca M, Singh SS, Bunn PT, Aguilera AR, Casey M, Braun M, Ghazanfari N, Wani S, Wang Y, Amante FH, Edwards CL, Haque A, Dougall WC, Singh OP, Baxter AG, Teng MWL, Loukas A, Daly NL, Cloonan N, Degli-Esposti MA, Uzonna J, Heath WR, Bald T, Tey SK, Nakamura K, Hill GR, Kumar R, Sundar S, Smyth MJ, Engwerda CR", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "32839608", "url": "https://glygen.org/publication/PubMed/32839608" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11438", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11438" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "Isolation and sequencing of a cDNA clone encoding lysosomal membrane glycoprotein mouse LAMP-1. Sequence similarity to proteins bearing onco-differentiation antigens.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Chen J.W., Cha Y., August J.T., Gracy R.W., Yuksel K.U.", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "reference": [ { "type": "PubMed", "id": "3379044", "url": "https://glygen.org/publication/PubMed/3379044" } ] } ], "pathway": [ { "id": "mmu:16783", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:16783", "resource": "KEGG Pathway" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P11279-1", "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI", "length": 417 }, "evidence": [ { "id": "45230861", "url": "http://www.informatics.jax.org/homology/45230861", "database": "MGI" }, { "id": "P11438", "url": "https://omabrowser.org/oma/group/P11438/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P14562-1", "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAPGARRPLLLLLLAGLAHSAPALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI", "length": 407 }, "evidence": [ { "id": "45230861", "url": "http://www.informatics.jax.org/homology/45230861", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "establishment of protein localization to organelle", "id": "GO:0072594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072594", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "Golgi to lysosome transport", "id": "GO:0090160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090160", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "positive regulation of natural killer cell degranulation", "id": "GO:0043323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043323", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "positive regulation of natural killer cell mediated cytotoxicity", "id": "GO:0045954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045954", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "autophagic cell death", "id": "GO:0048102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048102", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "regulation of organelle transport along microtubule", "id": "GO:1902513", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902513", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "granzyme-mediated programmed cell death signaling pathway", "id": "GO:0140507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140507", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 27, "go_terms": [ { "name": "autophagosome membrane", "id": "GO:0000421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000421", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "alveolar lamellar body", "id": "GO:0097208", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097208", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "synaptic vesicle membrane", "id": "GO:0030672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030672", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "sarcolemma", "id": "GO:0042383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042383", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "synaptic vesicle", "id": "GO:0008021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008021", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "multivesicular body", "id": "GO:0005771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005771", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "autolysosome", "id": "GO:0044754", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044754", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "cytolytic granule", "id": "GO:0044194", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044194", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "phagolysosome membrane", "id": "GO:0061474", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061474", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "cytolytic granule membrane", "id": "GO:0101004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0101004", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P11438", "url": "https://www.uniprot.org/uniprot/P11438" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 101, "end_pos": 103, "annotation": "n_glycosylation_sequon" }, { "start_pos": 115, "end_pos": 117, "annotation": "n_glycosylation_sequon" }, { "start_pos": 159, "end_pos": 161, "annotation": "n_glycosylation_sequon" }, { "start_pos": 177, "end_pos": 179, "annotation": "n_glycosylation_sequon" }, { "start_pos": 214, "end_pos": 216, "annotation": "n_glycosylation_sequon" }, { "start_pos": 219, "end_pos": 221, "annotation": "n_glycosylation_sequon" }, { "start_pos": 232, "end_pos": 234, "annotation": "n_glycosylation_sequon" }, { "start_pos": 240, "end_pos": 242, "annotation": "n_glycosylation_sequon" }, { "start_pos": 248, "end_pos": 250, "annotation": "n_glycosylation_sequon" }, { "start_pos": 252, "end_pos": 254, "annotation": "n_glycosylation_sequon" }, { "start_pos": 282, "end_pos": 284, "annotation": "n_glycosylation_sequon" }, { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 311, "end_pos": 313, "annotation": "n_glycosylation_sequon" }, { "start_pos": 31, "end_pos": 33, "annotation": "n_glycosylation_sequon" }, { "start_pos": 52, "end_pos": 54, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" }, { "start_pos": 70, "end_pos": 72, "annotation": "n_glycosylation_sequon" }, { "start_pos": 78, "end_pos": 80, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 51 }, { "field": "total_sites", "count": 20 }, { "field": "n_linked_glycans", "count": 22 }, { "field": "n_linked_glycan_sites", "count": 26 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 33 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 22 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }