{ "uniprot_canonical_ac": "P10648-1", "uniprot_ac": "P10648", "uniprot_id": "GSTA2_MOUSE", "mass": { "chemical_mass": 25542.0, "monoisotopic_mass": 25542.0 }, "refseq": { "ac": "NP_032208", "name": "glutathione S-transferase A2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032208" }, "gene_names": [ { "name": "Gsta2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10648", "id": "P10648" }, { "name": "Gst2-2; Gstc-2; Gstc2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032208", "id": "NP_032208" }, { "name": "Gsta2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032208", "id": "NP_032208" } ], "protein_names": [ { "name": "Glutathione S-transferase A2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10648" }, { "name": "2.5.1.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10648" }, { "name": "GST class-alpha member 2; glutathione S-transferase GT41A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032208", "id": "NP_032208" }, { "name": "GST class-alpha member 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10648" }, { "name": "Glutathione S-transferase GT41A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10648" }, { "name": "glutathione S-transferase A2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032208", "id": "NP_032208" } ], "function": [ { "annotation": "Catalyzes the conjugation of glutathione to a large variety of electrophilic compounds.", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648#function" }, { "database": "PubMed", "id": "9606968", "url": "https://glygen.org/publication/PubMed/9606968" } ] } ], "disease": [ { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ], "evidence": [ { "id": "2394", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2394" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gsta2", "url": "https://www.uniprot.org/uniprot/P10648", "locus": { "chromosome": "9", "start_pos": 78238300, "end_pos": 78263070, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000057933", "url": "https://www.ensembl.org/id/ENSMUSG00000057933" } ] } } ], "crossref": [ { "id": "ENSMUSG00000057933", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000057933", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03077", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03077", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03208", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03208", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "14858", "url": "https://www.ncbi.nlm.nih.gov/gene/14858", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003080", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003080", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004045", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004045", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004046", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004046", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010987", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010987", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036282", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036282", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:14858", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14858", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "95863", "url": "http://www.informatics.jax.org/marker/MGI:95863", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "EMIMQLP", "url": "https://omabrowser.org/oma/group/EMIMQLP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3412208at2759", "url": "http://www.orthodb.org/?query=3412208at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11571", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11571:SF233", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571:SF233", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1ML6", "url": "https://www.rcsb.org/structure/1ML6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00043", "url": "http://pfam.xfam.org/family/PF00043", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02798", "url": "http://pfam.xfam.org/family/PF02798", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P10648", "url": "http://purl.obolibrary.org/obo/PR_P10648", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-189483", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9748787", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_032208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032208", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16437", "url": "https://www.rhea-db.org/rhea/16437", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "D3YZV3", "url": "https://www.uniprot.org/uniprot/D3YZV3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YZV3-1", "url": "https://www.uniprot.org/uniprot/D3YZV3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z6A6", "url": "https://www.uniprot.org/uniprot/D3Z6A6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z6A6-1", "url": "https://www.uniprot.org/uniprot/D3Z6A6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10648-1", "url": "https://www.uniprot.org/uniprot/P10648-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF", "length": 222, "header": "sp|P10648-1|GSTA2_MOUSE Isoform 1 of Glutathione S-transferase A2 OS=Mus musculus OX=10090 GN=Gsta2 PE=1 SV=3 CANONICAL=P10648-1" }, "isoforms": [ { "isoform_ac": "D3YZV3-1", "url": "", "sequence": { "sequence": "MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLK", "length": 182, "header": "tr|D3YZV3-1|D3YZV3_MOUSE Computationally mapped isoform of Glutathione S-transferase OS=Mus musculus OX=10090 GN=Gsta2 PE=1 SV=1 CANONICAL=P10648-1" }, "locus": { "chromosome": "9", "start_pos": 78249198, "end_pos": 78239369, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000125479.8", "url": "https://www.ensembl.org/id/ENSMUST00000125479.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000115517.2", "url": "https://www.ensembl.org/id/ENSMUSP00000115517.2" } ] } }, { "isoform_ac": "D3Z6A6-1", "url": "", "sequence": { "sequence": "MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFP", "length": 179, "header": "tr|D3Z6A6-1|D3Z6A6_MOUSE Computationally mapped isoform of Glutathione S-transferase OS=Mus musculus OX=10090 GN=Gsta2 PE=3 SV=1 CANONICAL=P10648-1" }, "locus": { "chromosome": "9", "start_pos": 78249198, "end_pos": 78239378, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000129247.2", "url": "https://www.ensembl.org/id/ENSMUST00000129247.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000117101.2", "url": "https://www.ensembl.org/id/ENSMUSP00000117101.2" } ] } }, { "isoform_ac": "P10648-1", "url": "", "sequence": { "sequence": "MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF", "length": 222, "header": "sp|P10648-1|GSTA2_MOUSE Isoform 1 of Glutathione S-transferase A2 OS=Mus musculus OX=10090 GN=Gsta2 PE=1 SV=3 CANONICAL=P10648-1" }, "locus": { "chromosome": "9", "start_pos": 78249198, "end_pos": 78238412, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000034902", "url": "https://www.ensembl.org/id/ENSMUST00000034902" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000034902", "url": "https://www.ensembl.org/id/ENSMUSP00000034902" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Residues 207, 216, and 221 and the catalytic activity of mGSTA1-1 and mGSTA2-2 toward benzo[a]pyrene-(7R,8S)-diol-(9S,10R)-epoxide.", "journal": "Biochemistry", "date": "2003", "authors": "Gu Y, Xiao B, Wargo HL, Bucher MH, Singh SV, Ji X", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "reference": [ { "type": "PubMed", "id": "12549910", "url": "https://glygen.org/publication/PubMed/12549910" } ] }, { "title": "Tissue-specific induction of murine glutathione transferase mRNAs by butylated hydroxyanisole.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Anderson K.S., Pearson W.R., Adler P.N., Reinhart J., Sisk S.C.", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "reference": [ { "type": "PubMed", "id": "3417659", "url": "https://glygen.org/publication/PubMed/3417659" } ] }, { "title": "Cloning, expression, and biochemical characterization of a functionally novel alpha class glutathione S-transferase with exceptional activity in the glutathione conjugation of (+)-anti-7,8-dihydroxy-9,10-oxy-7,8,9,10-tetrahydrobenzo(a)pyrene.", "journal": "Arch. Biochem. Biophys.", "date": "1998", "authors": "Hu X., Srivastava S.K., Xia H., Pal A., Pan S.S., Singh S.V.", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "reference": [ { "type": "PubMed", "id": "9606968", "url": "https://glygen.org/publication/PubMed/9606968" } ] } ], "pathway": [ { "id": "mmu:14858", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14858", "resource": "KEGG Pathway" }, { "id": "R-MMU-156590", "name": "Glutathione conjugation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "resource": "Reactome", "description": "Glutathione conjugation" }, { "id": "R-MMU-189483", "name": "Heme degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-189483", "resource": "Reactome", "description": "Heme degradation" }, { "id": "R-MMU-9748787", "name": "Azathioprine ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9748787", "resource": "Reactome", "description": "Azathioprine ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "P00502-1", "protein_name": "Glutathione S-transferase alpha-1", "gene_name": "Gsta1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF", "length": 222 }, "evidence": [ { "id": "45237589", "url": "http://www.informatics.jax.org/homology/45237589", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P04903-1", "protein_name": "Glutathione S-transferase alpha-2", "gene_name": "Gsta2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF", "length": 222 }, "evidence": [ { "id": "45237589", "url": "http://www.informatics.jax.org/homology/45237589", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P04904-1", "protein_name": "Glutathione S-transferase alpha-3", "gene_name": "Gsta3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEQFLKTRDDLARLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYAEGVADLDEIVLHYPYIPPGEKEASLAKIKDKARNRYFPAFEKVLKSHGQDYLVGNRLSRADVYLVQVLYHVEELDPSALANFPLLKALRTRVSNLPTVKKFLQPGSQRKPLEDEKCVESAVKIFS", "length": 221 }, "evidence": [ { "id": "45237589", "url": "http://www.informatics.jax.org/homology/45237589", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF", "length": 222 }, "evidence": [ { "id": "45237589", "url": "http://www.informatics.jax.org/homology/45237589", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P09210-1", "protein_name": "Glutathione S-transferase A2", "gene_name": "GSTA2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF", "length": 222 }, "evidence": [ { "id": "45237589", "url": "http://www.informatics.jax.org/homology/45237589", "database": "MGI" }, { "id": "P10648", "url": "https://omabrowser.org/oma/group/P10648/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF", "length": 222 }, "evidence": [ { "id": "45237589", "url": "http://www.informatics.jax.org/homology/45237589", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q7RTV2-1", "protein_name": "Glutathione S-transferase A5", "gene_name": "GSTA5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF", "length": 222 }, "evidence": [ { "id": "45237589", "url": "http://www.informatics.jax.org/homology/45237589", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "glutathione transferase activity", "id": "GO:0004364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "glutathione binding", "id": "GO:0043295", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043295", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "fatty acid binding", "id": "GO:0005504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005504", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "steroid delta-isomerase activity", "id": "GO:0004769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004769", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "dinitrosyl-iron complex binding", "id": "GO:0035731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035731", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "glutathione peroxidase activity", "id": "GO:0004602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004602", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "response to bacterium", "id": "GO:0009617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009617", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "response to stilbenoid", "id": "GO:0035634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035634", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" }, { "name": "glutathione metabolic process", "id": "GO:0006749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749", "evidence": [ { "database": "UniProtKB", "id": "P10648", "url": "https://www.uniprot.org/uniprot/P10648" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16437", "name": "", "equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04904-1", "P46418-1", "P24473-1", "P30713-1", "Q6AXY0-1", "Q9QX69-1", "O35543-1", "Q9Z339-1", "P08009-1", "P14942-1", "Q9Z1B2-1", "Q6AXV9-1", "Q5BK56-1", "P00502-1", "P04903-1", "P04905-1", "P04906-1", "P57113-1", "Q01579-1", "P08010-1", "P08011-1", "Q4V8E6-1", "A0A0G2K4Q5-1", "A0A8I5ZLR0-1", "Q9Y2Q3-1", "Q9H4Y5-1", "P46439-1", "Q03013-1", "P78417-1", "P08263-1", "P0CG30-1", "P09488-1", "Q7RTV2-1", "Q16772-1", "P28161-1", "P0CG29-1", "O60760-1", "P09211-1", "P30711-1", "P09210-1", "O15217-1", "O43813-1", "P21266-1", "P10620-1", "O43708-1", "Q99735-1", "A0A1W2PR19-1", "A0A1W2PRG0-1", "F6RWR5-1", "P19157-1", "Q9JHF7-1", "E9Q6L7-1", "Q61133-1", "Q9WVL0-1", "O35660-1", "P46425-1", "P19639-1", "P48774-1", "Q9DCM2-1", "Q99L20-1", "O09131-1", "P24472-1", "Q8K2Q2-1", "Q80W21-1", "O89112-1", "P10648-1", "P13745-1", "P15626-1", "P30115-1", "P10649-1", "Q64471-1", "Q9D4P7-1", "Q91VS7-1", "Q6P8Q0-1", "A2RST1-1", "Q8R5I6-1", "P17695-1", "P25373-1", "P36156-1", "P40582-1", "P48239-1", "Q04806-1", "Q12390-1", "Q54GA9-1", "Q54QV7-1", "Q54VI4-1", "Q55FF3-1", "Q86AU1-1", "Q556G3-1", "Q9VG94-1", "Q9VG96-1", "Q7JYX0-1", "E1JJS1-1", "P41043-1", "P20432-1", "Q9VG95-1", "Q9VG98-1", "Q9VG93-1", "Q9VHD3-1", "Q9VHD2-1", "Q7K0B6-1", "Q8MRM0-1" ], "evidence": [ { "id": "16437", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16437" } ] }, { "id": "R-MMU-176054", "name": "GST dimers conjugate GSH with cytosolic substrates", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q61133-1", "Q8K2Q2-1", "E9Q6L7-1", "Q8R5I6-1", "P30115-1", "P13745-1", "P19157-1", "P19639-1", "Q9JHF7-1", "Q9WVL0-1", "Q6P8Q0-1", "P10649-1", "P10648-1", "O09131-1", "O35660-1", "P15626-1", "Q64471-1", "Q80W21-1", "P48774-1" ], "evidence": [ { "id": "R-MMU-176054", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-176054" } ] }, { "id": "R-MMU-9663492", "name": "BIL dissociates from GSTA1, FABP1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "E9Q6L7-1", "P30115-1", "P13745-1", "Q6P8Q0-1", "P10648-1" ], "evidence": [ { "id": "R-MMU-9663492", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9663492" } ] }, { "id": "R-MMU-9663511", "name": "BIL binds GSTA1, FABP1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "E9Q6L7-1", "P30115-1", "P13745-1", "Q6P8Q0-1", "P10648-1" ], "evidence": [ { "id": "R-MMU-9663511", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9663511" } ] }, { "id": "R-MMU-9748996", "name": "GST dimers cleave AZA to 6MP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9748994" ], "output_participant_list": [ "R-ALL-9748998", "R-ALL-9748975" ], "enzyme_list": [ "E9Q6L7-1", "P30115-1", "P13745-1", "Q6P8Q0-1", "P10648-1", "P15626-1" ], "evidence": [ { "id": "R-MMU-9748996", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9748996" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-9748975", "participant_name": "GS-nitroimidazole [cytosol]", "crossref": [ { "id": "180931", "database": "ChEBI", "url": "" }, { "id": "180931", "database": "ChEBI", "url": "" }, { "id": "180931", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9748994", "participant_name": "AZA [cytosol]", "crossref": [ { "id": "7120", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00620", "database": "PharmacoDB", "url": "" }, { "id": "PDBC00620", "database": "PharmacoDB", "url": "" }, { "id": "7120", "database": "Guide to Pharmacology", "url": "" }, { "id": "7120", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00620", "database": "PharmacoDB", "url": "" } ] }, { "participant_id": "R-ALL-9748998", "participant_name": "6MP [cytosol]", "crossref": [ { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" }, { "id": "50667", "database": "ChEBI", "url": "" }, { "id": "7226", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC00164", "database": "PharmacoDB", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K4Q5", "gene_name": "Gstp3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A0G2K4Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A0G2K4Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5" } ] } ] }, { "uniprot_ac": "A0A1W2PR19", "gene_name": "GSTT4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] } ] }, { "uniprot_ac": "A0A1W2PRG0", "gene_name": "", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A1W2PRG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PRG0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A1W2PRG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PRG0" } ] } ] }, { "uniprot_ac": "A0A8I5ZLR0", "gene_name": "Gstt3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A8I5ZLR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZLR0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A8I5ZLR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZLR0" } ] } ] }, { "uniprot_ac": "A2RST1", "gene_name": "Mgst2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] } ] }, { "uniprot_ac": "E1JJS1", "gene_name": "GstT3", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "E1JJS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E1JJS1" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "E1JJS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E1JJS1" } ] } ] }, { "uniprot_ac": "E9Q6L7", "gene_name": "Gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "E9Q6L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q6L7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "E9Q6L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q6L7" } ] } ] }, { "uniprot_ac": "F6RWR5", "gene_name": "Gstp3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "F6RWR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F6RWR5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F6RWR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F6RWR5" } ] } ] }, { "uniprot_ac": "O09131", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] } ] }, { "uniprot_ac": "O15217", "gene_name": "GSTA4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] } ] }, { "uniprot_ac": "O35543", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] } ] }, { "uniprot_ac": "O35660", "gene_name": "Gstm6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] } ] }, { "uniprot_ac": "O43708", "gene_name": "GSTZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] } ] }, { "uniprot_ac": "O43813", "gene_name": "LANCL1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] } ] }, { "uniprot_ac": "O60760", "gene_name": "HPGDS", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] } ] }, { "uniprot_ac": "O89112", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] } ] }, { "uniprot_ac": "P00502", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] } ] }, { "uniprot_ac": "P04903", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] } ] }, { "uniprot_ac": "P04904", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04904" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04904" } ] } ] }, { "uniprot_ac": "P04905", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] } ] }, { "uniprot_ac": "P04906", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] } ] }, { "uniprot_ac": "P08009", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] } ] }, { "uniprot_ac": "P08010", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] } ] }, { "uniprot_ac": "P08011", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] } ] }, { "uniprot_ac": "P08263", "gene_name": "GSTA1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] } ] }, { "uniprot_ac": "P09210", "gene_name": "GSTA2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] } ] }, { "uniprot_ac": "P09211", "gene_name": "GSTP1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] } ] }, { "uniprot_ac": "P09488", "gene_name": "GSTM1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] } ] }, { "uniprot_ac": "P0CG29", "gene_name": "GSTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] } ] }, { "uniprot_ac": "P0CG30", "gene_name": "GSTT2B", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] } ] }, { "uniprot_ac": "P10620", "gene_name": "MGST1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] } ] }, { "uniprot_ac": "P10648", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] } ] }, { "uniprot_ac": "P10649", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] } ] }, { "uniprot_ac": "P13745", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] } ] }, { "uniprot_ac": "P14942", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] } ] }, { "uniprot_ac": "P15626", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] } ] }, { "uniprot_ac": "P17695", "gene_name": "GRX2", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] } ] }, { "uniprot_ac": "P19157", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] } ] }, { "uniprot_ac": "P19639", "gene_name": "Gstm3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] } ] }, { "uniprot_ac": "P20432", "gene_name": "GstD1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride + H(+).", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] } ] }, { "uniprot_ac": "P21266", "gene_name": "GSTM3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] } ] }, { "uniprot_ac": "P24472", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] } ] }, { "uniprot_ac": "P24473", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] } ] }, { "uniprot_ac": "P25373", "gene_name": "GRX1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] } ] }, { "uniprot_ac": "P28161", "gene_name": "GSTM2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] } ] }, { "uniprot_ac": "P30115", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] } ] }, { "uniprot_ac": "P30711", "gene_name": "GSTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] } ] }, { "uniprot_ac": "P30713", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] } ] }, { "uniprot_ac": "P36156", "gene_name": "ECM4", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] } ] }, { "uniprot_ac": "P40582", "gene_name": "GTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P40582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40582" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P40582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40582" } ] } ] }, { "uniprot_ac": "P41043", "gene_name": "GstS1", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] } ] }, { "uniprot_ac": "P46418", "gene_name": "Gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46418" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46418" } ] } ] }, { "uniprot_ac": "P46425", "gene_name": "Gstp2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] } ] }, { "uniprot_ac": "P46439", "gene_name": "GSTM5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] } ] }, { "uniprot_ac": "P48239", "gene_name": "GTO1", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] } ] }, { "uniprot_ac": "P48774", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] } ] }, { "uniprot_ac": "P57113", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] } ] }, { "uniprot_ac": "P78417", "gene_name": "GSTO1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] } ] }, { "uniprot_ac": "Q01579", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] } ] }, { "uniprot_ac": "Q03013", "gene_name": "GSTM4", "activity": [ { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] } ] }, { "uniprot_ac": "Q04806", "gene_name": "GTO3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q04806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04806" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q04806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04806" } ] } ] }, { "uniprot_ac": "Q12390", "gene_name": "GTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q12390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12390" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q12390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12390" } ] } ] }, { "uniprot_ac": "Q16772", "gene_name": "GSTA3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] } ] }, { "uniprot_ac": "Q4V8E6", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] } ] }, { "uniprot_ac": "Q54GA9", "gene_name": "mgst", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GA9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GA9" } ] } ] }, { "uniprot_ac": "Q54QV7", "gene_name": "gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] } ] }, { "uniprot_ac": "Q54VI4", "gene_name": "gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] } ] }, { "uniprot_ac": "Q556G3", "gene_name": "gsta2-2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] } ] }, { "uniprot_ac": "Q55FF3", "gene_name": "gsta1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] } ] }, { "uniprot_ac": "Q5BK56", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] } ] }, { "uniprot_ac": "Q61133", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] } ] }, { "uniprot_ac": "Q64471", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] } ] }, { "uniprot_ac": "Q6AXV9", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] } ] }, { "uniprot_ac": "Q6AXY0", "gene_name": "Gsta6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] } ] }, { "uniprot_ac": "Q6P8Q0", "gene_name": "Gm3776", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] } ] }, { "uniprot_ac": "Q7JYX0", "gene_name": "GstE14", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] } ] }, { "uniprot_ac": "Q7K0B6", "gene_name": "GstT1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q7K0B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K0B6" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7K0B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K0B6" } ] } ] }, { "uniprot_ac": "Q7RTV2", "gene_name": "GSTA5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] } ] }, { "uniprot_ac": "Q80W21", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] } ] }, { "uniprot_ac": "Q86AU1", "gene_name": "gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] } ] }, { "uniprot_ac": "Q8K2Q2", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] } ] }, { "uniprot_ac": "Q8MRM0", "gene_name": "GstT4", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q8MRM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MRM0" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8MRM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MRM0" } ] } ] }, { "uniprot_ac": "Q8R5I6", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] } ] }, { "uniprot_ac": "Q91VS7", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] } ] }, { "uniprot_ac": "Q99735", "gene_name": "MGST2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] } ] }, { "uniprot_ac": "Q99L20", "gene_name": "Gstt3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] } ] }, { "uniprot_ac": "Q9D4P7", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] } ] }, { "uniprot_ac": "Q9DCM2", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] } ] }, { "uniprot_ac": "Q9H4Y5", "gene_name": "GSTO2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] } ] }, { "uniprot_ac": "Q9JHF7", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] } ] }, { "uniprot_ac": "Q9QX69", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] } ] }, { "uniprot_ac": "Q9VG93", "gene_name": "GstD7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] } ] }, { "uniprot_ac": "Q9VG94", "gene_name": "GstD6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] } ] }, { "uniprot_ac": "Q9VG95", "gene_name": "GstD5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] } ] }, { "uniprot_ac": "Q9VG96", "gene_name": "GstD4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] } ] }, { "uniprot_ac": "Q9VG98", "gene_name": "GstD2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] } ] }, { "uniprot_ac": "Q9VHD2", "gene_name": "GstZ2", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] } ] }, { "uniprot_ac": "Q9VHD3", "gene_name": "GstZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] } ] }, { "uniprot_ac": "Q9WVL0", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] } ] }, { "uniprot_ac": "Q9Y2Q3", "gene_name": "GSTK1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] } ] }, { "uniprot_ac": "Q9Z1B2", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] } ] }, { "uniprot_ac": "Q9Z339", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }