{ "uniprot_canonical_ac": "P10252-1", "uniprot_ac": "P10252", "uniprot_id": "CD48_RAT", "mass": { "chemical_mass": 27680.0, "monoisotopic_mass": 27680.0 }, "refseq": { "ac": "NP_620803", "name": "CD48 antigen precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620803" }, "gene_names": [ { "name": "Cd48", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10252", "id": "P10252" }, { "name": "Bcm-1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10252", "id": "P10252" }, { "name": "Cd48", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620803", "id": "NP_620803" }, { "name": "SLAMF2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620803", "id": "NP_620803" } ], "protein_names": [ { "name": "CD48 antigen", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10252" }, { "name": "BCM1 surface antigen", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10252" }, { "name": "BLAST-1; BCM1 surface antigen; MRC OX-45 surface antigen; CD48 antigen; SLAM family member 2; signaling lymphocytic activation molecule 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620803", "id": "NP_620803" }, { "name": "BLAST-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10252" }, { "name": "CD48 antigen precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620803", "id": "NP_620803" }, { "name": "MRC OX-45 surface antigen", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10252" }, { "name": "SLAM family member 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10252" }, { "name": "SLAMF2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10252" }, { "name": "Signaling lymphocytic activation molecule 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10252" } ], "function": [ { "annotation": "CD48 is a CD2 and CD244 (2B4)-binding protein", "evidence": [ { "database": "RefSeq", "id": "NP_620803", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620803" }, { "database": "PubMed", "id": "16803907", "url": "https://glygen.org/publication/PubMed/16803907" } ] }, { "annotation": "Glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein that interacts via its N-terminal immunoglobulin domain with cell surface receptors including 2B4/CD244 or CD2 to regulate immune cell function and activation. Participates in T-cell signaling transduction by associating with CD2 and efficiently bringing the Src family protein kinase LCK and LAT to the TCR/CD3 complex. In turn, promotes LCK phosphorylation and subsequent activation. Induces the phosphorylation of the cytoplasmic immunoreceptortyrosine switch motifs (ITSMs) of CD244 initiating a series of signaling events that leads to the generation of the immunological synapse and the directed release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells.", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252#function" }, { "database": "UniProtKB", "id": "P09326", "url": "https://www.uniprot.org/uniprot/P09326#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs105755460", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs105755460" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 140, "end_pos": 140, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "13", "chr_pos": "84203044", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N140", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cd48", "url": "https://www.uniprot.org/uniprot/P10252", "locus": { "chromosome": "13", "start_pos": 84209142, "end_pos": 84185532, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000004737", "url": "https://www.ensembl.org/id/ENSRNOG00000004737" } ] } } ], "crossref": [ { "id": "ENSRNOG00000004737", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000004737", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05775", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05775", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "245962", "url": "https://www.ncbi.nlm.nih.gov/gene/245962", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "371", "url": "https://glyconnect.expasy.org/browser/proteins/371", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:245962", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:245962", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YFNTKFK", "url": "https://omabrowser.org/oma/group/YFNTKFK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5265418at2759", "url": "http://www.orthodb.org/?query=5265418at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12080", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12080", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12080:SF105", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12080:SF105", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2DRU", "url": "https://www.rcsb.org/structure/2DRU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF07686", "url": "http://pfam.xfam.org/family/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13895", "url": "http://pfam.xfam.org/family/PF13895", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P10252", "url": "http://purl.obolibrary.org/obo/PR_P10252", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_620803", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620803", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "620620", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620620", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZNL0", "url": "https://www.uniprot.org/uniprot/A0A8I5ZNL0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZNL0-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZNL0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZYW8", "url": "https://www.uniprot.org/uniprot/A0A8I5ZYW8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZYW8-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZYW8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q3B4", "url": "https://www.uniprot.org/uniprot/A0A8L2Q3B4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q3B4-1", "url": "https://www.uniprot.org/uniprot/A0A8L2Q3B4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10252-1", "url": "https://www.uniprot.org/uniprot/P10252-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYFKKRRWFLILESLLLSLVTGFQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLARSSGVHWIAAWLVVTLSIIPSILLA", "length": 240, "header": "sp|P10252-1|CD48_RAT Isoform 1 of CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1 CANONICAL=P10252-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZNL0-1", "url": "", "sequence": { "sequence": "MYFKKRRWFLILESLLLSLVTGFQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLGKNYLPGS", "length": 222, "header": "tr|A0A8I5ZNL0-1|A0A8I5ZNL0_RAT Computationally mapped isoform of Cd48 molecule OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1 CANONICAL=P10252-1" }, "locus": { "chromosome": "13", "start_pos": 84203292, "end_pos": 84185630, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000113999.1", "url": "https://www.ensembl.org/id/ENSRNOT00000113999.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000079741.1", "url": "https://www.ensembl.org/id/ENSRNOP00000079741.1" } ] } }, { "isoform_ac": "A0A8I5ZYW8-1", "url": "", "sequence": { "sequence": "MYFKKRRWFLILESLLLSLVTGFQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYARSSGVHWIAAWLVVTLSIIPSILLA", "length": 151, "header": "tr|A0A8I5ZYW8-1|A0A8I5ZYW8_RAT Computationally mapped isoform of Cd48 molecule OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1 CANONICAL=P10252-1" }, "locus": { "chromosome": "13", "start_pos": 84208475, "end_pos": 84185630, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000111655.1", "url": "https://www.ensembl.org/id/ENSRNOT00000111655.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000084304.1", "url": "https://www.ensembl.org/id/ENSRNOP00000084304.1" } ] } }, { "isoform_ac": "A0A8L2Q3B4-1", "url": "", "sequence": { "sequence": "MYFKKRRWFLILESLLLSLVTGFQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLGDRE", "length": 218, "header": "tr|A0A8L2Q3B4-1|A0A8L2Q3B4_RAT Computationally mapped isoform of Cd48 molecule OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1 CANONICAL=P10252-1" }, "locus": { "chromosome": "13", "start_pos": 84206566, "end_pos": 84185630, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000006306.8", "url": "https://www.ensembl.org/id/ENSRNOT00000006306.8" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000006306.5", "url": "https://www.ensembl.org/id/ENSRNOP00000006306.5" } ] } }, { "isoform_ac": "P10252-1", "url": "", "sequence": { "sequence": "MYFKKRRWFLILESLLLSLVTGFQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLARSSGVHWIAAWLVVTLSIIPSILLA", "length": 240, "header": "sp|P10252-1|CD48_RAT Isoform 1 of CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1 CANONICAL=P10252-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "P10252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10252#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "P10252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10252#ptm_processing" }, { "id": "3181129", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3181129" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 203, "start_aa": "Asn", "end_pos": 203, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn203", "evidence": [ { "id": "P10252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10252#ptm_processing" }, { "id": "3181129", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3181129" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 38, "start_aa": "Asn", "end_pos": 38, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn38", "evidence": [ { "id": "P10252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10252#ptm_processing" }, { "id": "16803907", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16803907" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 97, "start_aa": "Asn", "end_pos": 97, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn97", "evidence": [ { "id": "P10252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10252#ptm_processing" }, { "id": "16803907", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16803907" } ] }, { "glytoucan_ac": "G00176HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G00670OT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G07483YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G27919IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G29011JC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G36134VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G40124HY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G58667NI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G77149EE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G90426CG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "371", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/371" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells.", "journal": "Glycobiology", "date": "1999", "authors": "Rudd PM, Wormald MR, Harvey DJ, Devasahayam M, McAlister MS, Brown MH, Davis SJ, Barclay AN, Dwek RA", "evidence": [ { "database": "GlyConnect", "id": "371", "url": "https://glyconnect.expasy.org/browser/proteins/371" } ], "reference": [ { "type": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "title": "Crystal structure and binding properties of the CD2 and CD244 (2B4)-binding protein, CD48.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Evans EJ, Castro MA, O'Brien R, Kearney A, Walsh H, Sparks LM, Tucknott MG, Davies EA, Carmo AM, van der Merwe PA, Stuart DI, Jones EY, Ladbury JE, Ikemizu S, Davis SJ", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252#ptm_processing" }, { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" }, { "database": "RefSeq", "id": "NP_620803", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620803" } ], "reference": [ { "type": "PubMed", "id": "16803907", "url": "https://glygen.org/publication/PubMed/16803907" } ] }, { "title": "The MRC OX-45 antigen of rat leukocytes and endothelium is in a subset of the immunoglobulin superfamily with CD2, LFA-3 and carcinoembryonic antigens.", "journal": "The EMBO journal", "date": "1988", "authors": "Killeen N, Moessner R, Arvieux J, Willis A, Williams AF", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252#ptm_processing" }, { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "reference": [ { "type": "PubMed", "id": "3181129", "url": "https://glygen.org/publication/PubMed/3181129" } ] } ], "pathway": [ { "id": "rno:245962", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:245962", "resource": "KEGG Pathway" }, { "id": "R-RNO-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" } ], "orthologs": [ { "uniprot_canonical_ac": "P09326-1", "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT", "length": 243 }, "evidence": [ { "id": "45238686", "url": "http://www.informatics.jax.org/homology/45238686", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P18181-1", "protein_name": "CD48 antigen", "gene_name": "Cd48", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCFIKQGWCLVLELLLLPLGTGFQGHSIPDINATTGSNVTLKIHKDPLGPYKRITWLHTKNQKILEYNYNSTKTIFESEFKGRVYLEENNGALHISNVRKEDKGTYYMRVLRETENELKITLEVFDPVPKPSIEINKTEASTDSCHLRLSCEVKDQHVDYTWYESSGPFPKKSPGYVLDLIVTPQNKSTFYTCQVSNPVSSKNDTVYFTLPCDLARSSGVCWTATWLVVTTLIIHRILLT", "length": 240 }, "evidence": [ { "id": "45238686", "url": "http://www.informatics.jax.org/homology/45238686", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "pmid": "" }, { "name": "T cell activation", "id": "GO:0042110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042110", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "pmid": "" }, { "name": "mast cell activation", "id": "GO:0045576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045576", "evidence": [ { "database": "UniProtKB", "id": "P10252", "url": "https://www.uniprot.org/uniprot/P10252" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 140, "end_pos": 142, "annotation": "n_glycosylation_sequon" }, { "start_pos": 186, "end_pos": 188, "annotation": "n_glycosylation_sequon" }, { "start_pos": 203, "end_pos": 205, "annotation": "n_glycosylation_sequon" }, { "start_pos": 38, "end_pos": 40, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 39 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 34 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 34 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 34 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }