{ "uniprot_canonical_ac": "P0CY03-1", "uniprot_ac": "P0CY03", "uniprot_id": "YL15A_YEAST", "mass": { "chemical_mass": 4707.0, "monoisotopic_mass": 4707.0 }, "refseq": { "ac": "NP_878122", "name": "uncharacterized protein", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878122" }, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein YLR156C-A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0CY03" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878122", "id": "NP_878122" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P0CY03", "url": "https://www.uniprot.org/uniprot/P0CY03" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/P0CY03", "locus": {} } ], "crossref": [ { "id": "1466410", "url": "https://www.ncbi.nlm.nih.gov/gene/1466410", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1466411", "url": "https://www.ncbi.nlm.nih.gov/gene/1466411", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1466414", "url": "https://www.ncbi.nlm.nih.gov/gene/1466414", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1466415", "url": "https://www.ncbi.nlm.nih.gov/gene/1466415", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "sce:YLR154C-H", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR154C-H", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "sce:YLR156C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR156C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "sce:YLR157C-C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR157C-C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "sce:YLR159C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR159C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2052075at2759", "url": "http://www.orthodb.org/?query=2052075at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_P0CY03", "url": "http://purl.obolibrary.org/obo/PR_P0CY03", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_878122", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878122", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000028564", "url": "https://www.yeastgenome.org/locus/S000028564", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P0CY03", "url": "https://www.uniprot.org/uniprot/P0CY03", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0CY03-1", "url": "https://www.uniprot.org/uniprot/P0CY03-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW", "length": 43, "header": "sp|P0CY03-1|YL15A_YEAST Isoform 1 of Uncharacterized protein YLR156C-A OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=4 SV=1 CANONICAL=P0CY03-1" }, "isoforms": [ { "isoform_ac": "P0CY03-1", "url": "", "sequence": { "sequence": "MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW", "length": 43, "header": "sp|P0CY03-1|YL15A_YEAST Isoform 1 of Uncharacterized protein YLR156C-A OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=4 SV=1 CANONICAL=P0CY03-1" }, "locus": { "chromosome": "XII", "start_pos": 468958, "end_pos": 468830, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YLR154C-H_mRNA", "url": "https://www.ensembl.org/id/YLR154C-H_mRNA" }, { "database": "Ensembl Peptide", "id": "YLR154C-H", "url": "https://www.ensembl.org/id/YLR154C-H" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Systematic discovery of new genes in the Saccharomyces cerevisiae genome.", "journal": "Genome Res.", "date": "2003", "authors": "Zeng Q., Morales A.J., Cook R., Kessler M.M., Cottarel G., Hogan S.", "evidence": [ { "database": "UniProtKB", "id": "P0CY03", "url": "https://www.uniprot.org/uniprot/P0CY03" } ], "reference": [ { "type": "PubMed", "id": "12566404", "url": "https://glygen.org/publication/PubMed/12566404" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P0CY03", "url": "https://www.uniprot.org/uniprot/P0CY03" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "P0CY03", "url": "https://www.uniprot.org/uniprot/P0CY03" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] } ], "pathway": [ { "id": "sce:YLR154C-H", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR154C-H", "resource": "KEGG Pathway" }, { "id": "sce:YLR156C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR156C-A", "resource": "KEGG Pathway" }, { "id": "sce:YLR157C-C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR157C-C", "resource": "KEGG Pathway" }, { "id": "sce:YLR159C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR159C-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }