{ "uniprot_canonical_ac": "P0CX70-1", "uniprot_ac": "P0CX70", "uniprot_id": "YD15A_YEAST", "mass": { "chemical_mass": 48953.0, "monoisotopic_mass": 48953.0 }, "refseq": { "ac": "NP_058153", "name": "gag protein", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058153" }, "gene_names": [ { "name": "TY1A-DR6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0CX70", "id": "P0CX70" }, { "name": "D9481.12", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0CX70", "id": "P0CX70" }, { "name": "YDRWTy1-5 GAG", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0CX70", "id": "P0CX70" } ], "protein_names": [ { "name": "Transposon Ty1-DR6 Gag polyprotein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0CX70" }, { "name": "Gag-p45", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX70" }, { "name": "Gag-p49", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX70" }, { "name": "TY1A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX70" }, { "name": "TYA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX70" }, { "name": "Transposon Ty1 protein A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX70" }, { "name": "gag protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058153", "id": "NP_058153" }, { "name": "p54", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX70" }, { "name": "p58", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX70" } ], "function": [ { "annotation": "Capsid protein (CA) is the structural component of the virus-like particle (VLP), forming the shell that encapsulates the retrotransposons dimeric RNA genome. The particles are assembled from trimer-clustered units and there are holes in the capsid shells that allow for the diffusion of macromolecules. CA has also nucleocapsid-like chaperone activity, promoting primer tRNA(i)-Met annealing to the multipartite primer-binding site (PBS), dimerization of Ty1 RNA and initiation of reverse transcription (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "common_name": "Yeast" } ], "gene": [ { "name": "TY1A-DR6", "url": "https://www.uniprot.org/uniprot/P0CX70", "locus": {} } ], "crossref": [ { "id": "850854", "url": "https://www.ncbi.nlm.nih.gov/gene/850854", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "851970", "url": "https://www.ncbi.nlm.nih.gov/gene/851970", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "855816", "url": "https://www.ncbi.nlm.nih.gov/gene/855816", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "856880", "url": "https://www.ncbi.nlm.nih.gov/gene/856880", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR015820", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015820", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDR365W-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR365W-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "sce:YER137C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YER137C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "sce:YLR157C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR157C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "sce:YPL257W-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPL257W-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2039326at2759", "url": "http://www.orthodb.org/?query=2039326at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF01021", "url": "http://pfam.xfam.org/family/PF01021", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_058153", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058153", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000007400", "url": "https://www.yeastgenome.org/locus/S000007400", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0CX70-1", "url": "https://www.uniprot.org/uniprot/P0CX70-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPMYFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPNDFPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDILSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNNGIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNYRRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKSTTEPIQLNNKHDLHLRPGTY", "length": 440, "header": "sp|P0CX70-1|YD15A_YEAST Isoform 1 of Transposon Ty1-DR6 Gag polyprotein OS=Saccharomyces cerevisiae S288C OX=559292 GN=TY1A-DR6 PE=2 SV=1 CANONICAL=P0CX70-1" }, "isoforms": [ { "isoform_ac": "P0CX70-1", "url": "", "sequence": { "sequence": "MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPMYFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPNDFPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDILSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNNGIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNYRRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKSTTEPIQLNNKHDLHLRPGTY", "length": 440, "header": "sp|P0CX70-1|YD15A_YEAST Isoform 1 of Transposon Ty1-DR6 Gag polyprotein OS=Saccharomyces cerevisiae S288C OX=559292 GN=TY1A-DR6 PE=2 SV=1 CANONICAL=P0CX70-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 365, "end_pos": 365, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P0CX70", "url": "https://www.yeastgenome.org/locus/P0CX70" }, { "database": "iPTMnet", "id": "P0CX70", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX70" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser365" }, { "start_pos": 416, "end_pos": 416, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "site_lbl": "Ser416" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Differential effects of chromatin and Gcn4 on the 50-fold range of expression among individual yeast Ty1 retrotransposons.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Springer M., Lesage P., Morillon A., Benard L.", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "reference": [ { "type": "PubMed", "id": "11884596", "url": "https://glygen.org/publication/PubMed/11884596" } ] }, { "title": "Happy together: the life and times of Ty retrotransposons and their hosts.", "journal": "Cytogenet. Genome Res.", "date": "2005", "authors": "Todeschini A.L., Lesage P.", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "reference": [ { "type": "PubMed", "id": "16093660", "url": "https://glygen.org/publication/PubMed/16093660" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P0CX70", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX70" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P0CX70", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX70" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] }, { "title": "Transposable elements and genome organization: a comprehensive survey of retrotransposons revealed by the complete Saccharomyces cerevisiae genome sequence.", "journal": "Genome Res.", "date": "1998", "authors": "Boeke J.D., Kim J.M., Gabriel A., Voytas D.F., Vanguri S.", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "reference": [ { "type": "PubMed", "id": "9582191", "url": "https://glygen.org/publication/PubMed/9582191" } ] } ], "pathway": [ { "id": "sce:YDR365W-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR365W-A", "resource": "KEGG Pathway" }, { "id": "sce:YER137C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YER137C-A", "resource": "KEGG Pathway" }, { "id": "sce:YLR157C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR157C-A", "resource": "KEGG Pathway" }, { "id": "sce:YPL257W-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPL257W-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "retrotransposition", "id": "GO:0032197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032197", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "pmid": "" }, { "name": "retrotransposon nucleocapsid", "id": "GO:0000943", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000943", "evidence": [ { "database": "UniProtKB", "id": "P0CX70", "url": "https://www.uniprot.org/uniprot/P0CX70" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 278, "end_pos": 280, "annotation": "n_glycosylation_sequon" }, { "start_pos": 333, "end_pos": 335, "annotation": "n_glycosylation_sequon" }, { "start_pos": 363, "end_pos": 365, "annotation": "n_glycosylation_sequon" }, { "start_pos": 369, "end_pos": 371, "annotation": "n_glycosylation_sequon" }, { "start_pos": 376, "end_pos": 378, "annotation": "n_glycosylation_sequon" }, { "start_pos": 391, "end_pos": 393, "annotation": "n_glycosylation_sequon" }, { "start_pos": 402, "end_pos": 404, "annotation": "n_glycosylation_sequon" }, { "start_pos": 407, "end_pos": 409, "annotation": "n_glycosylation_sequon" }, { "start_pos": 414, "end_pos": 416, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }